RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.21_1 (44 letters) >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Length = 308 Score = 25.3 bits (55), Expect = 1.4 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 1 MFYDVAKDILNHMEDNYLKESYIY--FFDIFLI 31 +F AK + + + ++ LK +Y +I I Sbjct: 207 LFLLAAKKVASCVTEDSLKVGRVYPQLKEIREI 239 >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Length = 294 Score = 24.2 bits (52), Expect = 3.1 Identities = 7/33 (21%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 1 MFYDVAKDILNHMEDNYLKESYIY--FFDIFLI 31 +F + AK + + + D L + +Y +I + Sbjct: 211 VFLEAAKALTSQLTDEELAQGRLYPPLANIQEV 243 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.336 0.155 0.487 Gapped Lambda K H 0.267 0.0559 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 191,703 Number of extensions: 6024 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 11 Length of query: 44 Length of database: 2,407,596 Length adjustment: 16 Effective length of query: 28 Effective length of database: 2,187,916 Effective search space: 61261648 Effective search space used: 61261648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 47 (22.3 bits)