Query 537021.9.peg.227_1 Match_columns 37 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 16:19:49 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_227.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam04516 CP2 CP2 transcriptio 66.9 5.8 0.00015 21.4 2.9 29 8-36 171-211 (237) 2 pfam01179 Cu_amine_oxid Copper 38.9 24 0.00061 18.2 2.3 23 3-25 23-45 (410) 3 pfam11615 DUF3249 Protein of u 25.7 34 0.00087 17.4 1.2 13 13-25 4-16 (60) 4 TIGR02441 fa_ox_alpha_mit fatt 22.0 41 0.0011 17.0 1.1 13 11-23 607-619 (740) 5 cd06236 M14_AGBL5_like Peptida 21.3 46 0.0012 16.7 1.2 22 6-27 169-193 (304) 6 KOG3314 consensus 18.3 54 0.0014 16.4 1.0 18 10-27 72-89 (194) 7 pfam03336 Pox_C4_C10 Poxvirus 17.3 79 0.002 15.5 1.7 16 22-37 184-201 (333) 8 pfam09965 DUF2199 Uncharacteri 17.2 83 0.0021 15.4 1.8 22 2-24 69-90 (147) 9 PRK11504 tynA tyramine oxidase 14.8 1.3E+02 0.0032 14.4 2.5 24 3-26 171-194 (571) 10 PRK13259 regulatory protein Sp 13.0 78 0.002 15.5 0.7 12 4-15 41-52 (94) No 1 >pfam04516 CP2 CP2 transcription factor. This family represents a conserved region in the CP2 transcription factor family. Probab=66.93 E-value=5.8 Score=21.40 Aligned_cols=29 Identities=34% Similarity=0.540 Sum_probs=19.4 Q ss_pred EEECCCCEEE---------EEE---CCCCCCCCEEEEEEEE Q ss_conf 9973541399---------983---3630123307999996 Q 537021.9.peg.2 8 VSFSSRKGIF---------LYQ---NNFYTQEKEVCYCKVV 36 (37) Q Consensus 8 vsfssrkgif---------lyq---nnfytqekevcyckvv 36 (37) ..||++||.- -|. +.-++..-++|||+|- T Consensus 171 TDFS~~KGvKGvP~rlqidT~~~~~~~~~~~~~h~~yCqVK 211 (237) T pfam04516 171 TDFSSSKGVKGVPLRLQIDTYDISSSPGTEEPAERAYCQVK 211 (237) T ss_pred CCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEE T ss_conf 45552478567856999876871788888876447888998 No 2 >pfam01179 Cu_amine_oxid Copper amine oxidase, enzyme domain. Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyse the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ). This family corresponds to the catalytic domain of the enzyme. Probab=38.91 E-value=24 Score=18.21 Aligned_cols=23 Identities=26% Similarity=0.665 Sum_probs=20.2 Q ss_pred EEEEEEEECCCCEEEEEECCCCC Q ss_conf 47899997354139998336301 Q 537021.9.peg.2 3 TWGLYVSFSSRKGIFLYQNNFYT 25 (37) Q Consensus 3 twglyvsfssrkgiflyqnnfyt 25 (37) -|.++++|..|.|+-|++-.|.- T Consensus 23 ~W~f~vgf~~reGl~L~dv~y~~ 45 (410) T pfam01179 23 NWSFRVGFNPREGLVLHDVRYDD 45 (410) T ss_pred CCEEEEEECCCCCEEEEEEEECC T ss_conf 86899972698770998678999 No 3 >pfam11615 DUF3249 Protein of unknown function (DUF3249). This family of proteins represents the gene product of the protein CAF4, the yeast protein YKR036c. This protein contains seven WD40 repeats in its C terminus. The function however is unknown. Probab=25.71 E-value=34 Score=17.41 Aligned_cols=13 Identities=46% Similarity=0.861 Sum_probs=10.4 Q ss_pred CCEEEEEECCCCC Q ss_conf 4139998336301 Q 537021.9.peg.2 13 RKGIFLYQNNFYT 25 (37) Q Consensus 13 rkgiflyqnnfyt 25 (37) .-|||-+|||+-. T Consensus 4 qvgifsfqnnyad 16 (60) T pfam11615 4 QVGIFSFQNNYAD 16 (60) T ss_pred EEEEEEEECCCCC T ss_conf 0668874045543 No 4 >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial; InterPro: IPR012803 Members of this family represent the alpha subunit of the mitochondrial multifunctional fatty acid degradation enzyme complex. Subunit activities include: enoyl-CoA hydratase (4.2.1.17 from EC) and 3-hydroxyacyl-CoA dehydrogenase (1.1.1.35 from EC). Some characterization of these proteins has been done in human (P40939 from SWISSPROT), pig (Q29554 from SWISSPROT) and rat (Q64428 from SWISSPROT). The beta subunit has acetyl-CoA C-acyltransferase (2.3.1.16 from EC) activity.; GO: 0003857 3-hydroxyacyl-CoA dehydrogenase activity, 0004300 enoyl-CoA hydratase activity, 0006635 fatty acid beta-oxidation, 0005739 mitochondrion, 0016507 fatty acid beta-oxidation multienzyme complex. Probab=21.98 E-value=41 Score=16.96 Aligned_cols=13 Identities=54% Similarity=0.856 Sum_probs=9.7 Q ss_pred CCCCEEEEEECCC Q ss_conf 3541399983363 Q 537021.9.peg.2 11 SSRKGIFLYQNNF 23 (37) Q Consensus 11 ssrkgiflyqnnf 23 (37) -|-||||+||..- T Consensus 607 K~GKGif~Y~~g~ 619 (740) T TIGR02441 607 KSGKGIFIYQEGK 619 (740) T ss_pred CCCCEEEEECCCE T ss_conf 0254068846835 No 5 >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the human AGBL5 and the mouse cytosolic carboxypeptidase (CCP)-5. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal Probab=21.31 E-value=46 Score=16.71 Aligned_cols=22 Identities=27% Similarity=0.771 Sum_probs=15.5 Q ss_pred EEEEE---CCCCEEEEEECCCCCCC Q ss_conf 99997---35413999833630123 Q 537021.9.peg.2 6 LYVSF---SSRKGIFLYQNNFYTQE 27 (37) Q Consensus 6 lyvsf---ssrkgiflyqnnfytqe 27 (37) +|+.| |+++|+|+|-|++-..+ T Consensus 169 ~yiDlHgHs~k~~~F~YGn~~~~~~ 193 (304) T cd06236 169 FYIDLHAHASKRGCFIYGNALEDES 193 (304) T ss_pred EEEECCCCCCCCCEEEECCCCCCHH T ss_conf 9997765657679788668878467 No 6 >KOG3314 consensus Probab=18.27 E-value=54 Score=16.38 Aligned_cols=18 Identities=33% Similarity=0.641 Sum_probs=15.4 Q ss_pred ECCCCEEEEEECCCCCCC Q ss_conf 735413999833630123 Q 537021.9.peg.2 10 FSSRKGIFLYQNNFYTQE 27 (37) Q Consensus 10 fssrkgiflyqnnfytqe 27 (37) |...+||.|-||+.++|. T Consensus 72 y~~~~gIvlCqN~l~~q~ 89 (194) T KOG3314 72 YTPGRGIVLCQNRLTIQD 89 (194) T ss_pred CCCCCCEEEECCCCCHHH T ss_conf 468873588335132599 No 7 >pfam03336 Pox_C4_C10 Poxvirus C4/C10 protein. Probab=17.28 E-value=79 Score=15.51 Aligned_cols=16 Identities=44% Similarity=1.240 Sum_probs=11.1 Q ss_pred CCCCCC--CEEEEEEEEC Q ss_conf 630123--3079999969 Q 537021.9.peg.2 22 NFYTQE--KEVCYCKVVI 37 (37) Q Consensus 22 nfytqe--kevcyckvvi 37 (37) |||..| +..|||-+.| T Consensus 184 ~lyd~E~d~~LCYC~i~I 201 (333) T pfam03336 184 NLYDKENDNTLCYCDITI 201 (333) T ss_pred EEEECCCCCEEEEEEEEE T ss_conf 587537896368999995 No 8 >pfam09965 DUF2199 Uncharacterized protein conserved in bacteria (DUF2199). This domain, found in various hypothetical bacterial proteins, has no known function. Probab=17.25 E-value=83 Score=15.40 Aligned_cols=22 Identities=32% Similarity=0.655 Sum_probs=13.4 Q ss_pred EEEEEEEEECCCCEEEEEECCCC Q ss_conf 04789999735413999833630 Q 537021.9.peg.2 2 LTWGLYVSFSSRKGIFLYQNNFY 24 (37) Q Consensus 2 ltwglyvsfssrkgiflyqnnfy 24 (37) +.||+.||.|- +..--|+..|- T Consensus 69 f~wGvWVslSe-~~F~~y~~~~~ 90 (147) T pfam09965 69 FRWGVWVSVSE-DSFEKYVETFG 90 (147) T ss_pred EEEEEEEEEEH-HHHHHHHHHHC T ss_conf 87865899609-99999999854 No 9 >PRK11504 tynA tyramine oxidase; Provisional Probab=14.78 E-value=1.3e+02 Score=14.43 Aligned_cols=24 Identities=29% Similarity=0.671 Sum_probs=20.7 Q ss_pred EEEEEEEECCCCEEEEEECCCCCC Q ss_conf 478999973541399983363012 Q 537021.9.peg.2 3 TWGLYVSFSSRKGIFLYQNNFYTQ 26 (37) Q Consensus 3 twglyvsfssrkgiflyqnnfytq 26 (37) .|-+-|+|..|.|+-|+|-.|.-+ T Consensus 171 ~W~frvgf~~ReGlvL~~v~y~D~ 194 (571) T PRK11504 171 NWSFRVGFNPREGLVLHQVTYNDG 194 (571) T ss_pred CCEEEEEECCCCCEEEEEEEECCC T ss_conf 737999716867618888797368 No 10 >PRK13259 regulatory protein SpoVG; Reviewed Probab=12.99 E-value=78 Score=15.54 Aligned_cols=12 Identities=25% Similarity=0.689 Sum_probs=9.3 Q ss_pred EEEEEEECCCCE Q ss_conf 789999735413 Q 537021.9.peg.2 4 WGLYVSFSSRKG 15 (37) Q Consensus 4 wglyvsfssrkg 15 (37) -||+|++.|||. T Consensus 41 ~GlFVaMPSrk~ 52 (94) T PRK13259 41 NGLFIAMPSKRT 52 (94) T ss_pred CCCEEECCCCCC T ss_conf 861898878488 Done!