Query         537021.9.peg.232_1
Match_columns 46
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed May 25 16:09:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_232.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2j6ba1 d.321.1.1 (A:1-109) Af  13.1      26  0.0019   15.8   0.6   30    2-34     46-75  (109)
  2 d1t4oa_ d.50.1.1 (A:) RNase II  11.1      40  0.0029   15.0   1.1   14   24-37      2-15  (81)
  3 d1li5a1 a.27.1.1 (A:316-402) C   4.3      85  0.0062   13.4  -0.0   14   13-26     34-47  (87)
  4 d1gm5a1 a.24.21.1 (A:7-105) Re   3.4 1.7E+02   0.013   12.0   1.7   14   32-45     58-71  (99)
  5 d2gy9b1 c.23.15.1 (B:8-225) Ri   3.4 1.3E+02  0.0098   12.5   0.4   33    5-41    162-194 (218)
  6 g1avo.1 a.24.8.1 (A:,B:) Prote   2.7 2.1E+02   0.016   11.6   0.8   15    4-18     85-99  (200)
  7 d1j75a_ a.4.5.19 (A:) Dlm-1 {M   2.4 2.3E+02   0.017   11.4   1.2   19    3-24     18-36  (57)
  8 d1ctfa_ d.45.1.1 (A:) Ribosoma   2.3 1.4E+02    0.01   12.4  -0.6   23    3-25     15-37  (68)
  9 d2j85a1 d.321.1.1 (A:2-116) Hy   2.3 2.4E+02   0.018   11.3   1.6   29    2-33     51-79  (115)
 10 d1xhoa_ d.79.1.2 (A:) Chorisma   2.2 2.5E+02   0.018   11.2   1.4   15    2-16     20-34  (112)

No 1  
>d2j6ba1 d.321.1.1 (A:1-109) Afv3-109 {Acidianus filamentous virus 1 [TaxId: 235266]}
Probab=13.15  E-value=26  Score=15.84  Aligned_cols=30  Identities=30%  Similarity=0.509  Sum_probs=23.1

Q ss_pred             CHHHHHHHHHHHCCCCHHHCCHHHHCCCHHHHH
Q ss_conf             139999999971456154406344057777866
Q 537021.9.peg.2    2 AATIQLVKEIISLNIPRAIANIDEIDMNPKQKI   34 (46)
Q Consensus         2 aatiqlvkeiislnipraianideidmnpkqki   34 (46)
                      ++|.|++..+...|+|-   |--+|-|++-+|.
T Consensus        46 ~aTAqlls~Llgv~i~~---NR~~i~~~~gDka   75 (109)
T d2j6ba1          46 QATAELLSSILGVNVPM---NRVQIKVTHGDRI   75 (109)
T ss_dssp             HHHHHHHHHHHTSCCCB---CCCCCCBCTTCEE
T ss_pred             HHHHHHHHHHHCCCCCC---CEEEEEECCCCEE
T ss_conf             98999999985863244---5058994589889


No 2  
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=11.08  E-value=40  Score=14.95  Aligned_cols=14  Identities=36%  Similarity=0.691  Sum_probs=10.2

Q ss_pred             HHHCCCHHHHHHHH
Q ss_conf             44057777866654
Q 537021.9.peg.2   24 DEIDMNPKQKISKY   37 (46)
Q Consensus        24 deidmnpkqkisky   37 (46)
                      |+||||+|.+.-.+
T Consensus         2 ~~id~~~K~~L~e~   15 (81)
T d1t4oa_           2 DKLDMNAKRQLYSL   15 (81)
T ss_dssp             CCCCTTHHHHHHHH
T ss_pred             CCCCCCHHHHHHHH
T ss_conf             85556899999999


No 3  
>d1li5a1 a.27.1.1 (A:316-402) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]}
Probab=4.26  E-value=85  Score=13.43  Aligned_cols=14  Identities=21%  Similarity=0.425  Sum_probs=9.7

Q ss_pred             HCCCCHHHCCHHHH
Q ss_conf             14561544063440
Q 537021.9.peg.2   13 SLNIPRAIANIDEI   26 (46)
Q Consensus        13 slnipraianidei   26 (46)
                      -+|.|.|+|.+-|+
T Consensus        34 DlNTp~Ala~lfel   47 (87)
T d1li5a1          34 DFNTPEAYSVLFDM   47 (87)
T ss_dssp             TSCHHHHHHHHHHH
T ss_pred             HCCCHHHHHHHHHH
T ss_conf             04829999999999


No 4  
>d1gm5a1 a.24.21.1 (A:7-105) RecG, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
Probab=3.42  E-value=1.7e+02  Score=11.97  Aligned_cols=14  Identities=36%  Similarity=0.427  Sum_probs=9.3

Q ss_pred             HHHHHHHHEEEECC
Q ss_conf             86665420102117
Q 537021.9.peg.2   32 QKISKYVIPMVNLN   45 (46)
Q Consensus        32 qkiskyvipmvnln   45 (46)
                      |+.-.|+.||-||+
T Consensus        58 qeF~~Yi~~~~~Lp   71 (99)
T d1gm5a1          58 QAFLDYVKEIPNLP   71 (99)
T ss_dssp             HHHHHHHTTSSSSC
T ss_pred             HHHHHHHHHHCCCC
T ss_conf             99999999850498


No 5  
>d2gy9b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
Probab=3.41  E-value=1.3e+02  Score=12.49  Aligned_cols=33  Identities=33%  Similarity=0.470  Sum_probs=19.5

Q ss_pred             HHHHHHHHHCCCCHHHCCHHHHCCCHHHHHHHHHHEE
Q ss_conf             9999999714561544063440577778666542010
Q 537021.9.peg.2    5 IQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPM   41 (46)
Q Consensus         5 iqlvkeiislnipraianideidmnpkqkiskyvipm   41 (46)
                      .+.++|-..++||- |+=+| -|.||  +.-.|.||.
T Consensus       162 ~~ai~Ea~~l~IP~-I~ivD-Tn~dp--~~idypIP~  194 (218)
T d2gy9b1         162 HIAIKEANNLGIPV-FAIVD-TNSDP--DGVDFVIPG  194 (218)
T ss_dssp             HHHHHHHHHTTCCE-EECCC-SSSCG--GGCTEECCS
T ss_pred             HHHHHHHHHCCCCE-EEEEE-CCCCC--CCCCEEEEC
T ss_conf             89999998759977-99964-79997--657666536


No 6  
>g1avo.1 a.24.8.1 (A:,B:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.67  E-value=2.1e+02  Score=11.55  Aligned_cols=15  Identities=40%  Similarity=0.736  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHCCCCH
Q ss_conf             999999997145615
Q 537021.9.peg.2    4 TIQLVKEIISLNIPR   18 (46)
Q Consensus         4 tiqlvkeiislnipr   18 (46)
                      .+..||.-|+|.|||
T Consensus        85 ~~~~vk~WV~l~IPk   99 (200)
T g1avo.1          85 QLNLVTTWLQLQIPR   99 (200)
T ss_dssp             HHHHHHHHHHHTCCC
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             998999999981773


No 7  
>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]}
Probab=2.41  E-value=2.3e+02  Score=11.38  Aligned_cols=19  Identities=32%  Similarity=0.324  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHCCCCHHHCCHH
Q ss_conf             3999999997145615440634
Q 537021.9.peg.2    3 ATIQLVKEIISLNIPRAIANID   24 (46)
Q Consensus         3 atiqlvkeiislnipraianid   24 (46)
                      .++||+||   ...|++.-|--
T Consensus        18 k~~ql~k~---cqVpkk~lNqV   36 (57)
T d1j75a_          18 KIGQLVKK---CQVPKKTLNQV   36 (57)
T ss_dssp             EHHHHHHH---HCSCHHHHHHH
T ss_pred             HHHHHHHH---HCCCHHHHHHH
T ss_conf             79999999---78878899999


No 8  
>d1ctfa_ d.45.1.1 (A:) Ribosomal protein L7/12, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=2.32  E-value=1.4e+02  Score=12.45  Aligned_cols=23  Identities=22%  Similarity=0.306  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHCCCCHHHCCHHH
Q ss_conf             39999999971456154406344
Q 537021.9.peg.2    3 ATIQLVKEIISLNIPRAIANIDE   25 (46)
Q Consensus         3 atiqlvkeiislnipraianide   25 (46)
                      +.|..|+++.+|+.-.|-.-++.
T Consensus        15 ~vIK~VR~it~lgLkEAK~lVe~   37 (68)
T d1ctfa_          15 AVIKAVRGATGLGLKEAKDLVES   37 (68)
T ss_dssp             HHHHHHHHHHCCCHHHHHHHHHT
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHC
T ss_conf             89999998459879999999872


No 9  
>d2j85a1 d.321.1.1 (A:2-116) Hypothetical protein B116 {Sulfolobus turreted icosahedral virus, STIV [TaxId: 269145]}
Probab=2.31  E-value=2.4e+02  Score=11.31  Aligned_cols=29  Identities=28%  Similarity=0.429  Sum_probs=20.1

Q ss_pred             CHHHHHHHHHHHCCCCHHHCCHHHHCCCHHHH
Q ss_conf             13999999997145615440634405777786
Q 537021.9.peg.2    2 AATIQLVKEIISLNIPRAIANIDEIDMNPKQK   33 (46)
Q Consensus         2 aatiqlvkeiislnipraianideidmnpkqk   33 (46)
                      ++|.|++..+...|+|.   |--+|-+++-++
T Consensus        51 ~aTAqlls~llgv~i~~---NRi~i~~~~gD~   79 (115)
T d2j85a1          51 DSTINLVNTLCGTQLQK---NRVEVKMNEGDE   79 (115)
T ss_dssp             HHHHHHHHHHHCCCCCC---CCCCCCBCTTCE
T ss_pred             HHHHHHHHHHHCCCCCC---CCEEEEECCCCE
T ss_conf             98999999973877676---744898358988


No 10 
>d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]}
Probab=2.20  E-value=2.5e+02  Score=11.23  Aligned_cols=15  Identities=40%  Similarity=0.361  Sum_probs=11.6

Q ss_pred             CHHHHHHHHHHHCCC
Q ss_conf             139999999971456
Q 537021.9.peg.2    2 AATIQLVKEIISLNI   16 (46)
Q Consensus         2 aatiqlvkeiislni   16 (46)
                      .||..|+.||++-|-
T Consensus        20 ~at~eLl~~ii~~N~   34 (112)
T d1xhoa_          20 AETQKLLKEMAEKNG   34 (112)
T ss_dssp             HHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             999999999999759


Done!