RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= 537021.9.peg.248_1
         (45 letters)



>gnl|CDD|153136 cd01586, AcnA_IRP, Aconitase A catalytic domain.  Aconitase A
           catalytic domain. This is the major form of the TCA
           cycle enzyme aconitate hydratase, also known as
           aconitase and citrate hydrolyase. It includes bacterial
           and archaeal aconitase A, and the eukaryotic cytosolic
           form of aconitase. This group also includes sequences
           that have been shown to act as an iron-responsive
           element (IRE) binding protein in animals and may have
           the same role in other eukaryotes.
          Length = 404

 Score = 25.7 bits (57), Expect = 2.9
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 6   LQAGSLVATGFLEKIFVGNFLDSLSFPCFIGISCGACI 43
           L  GS V T +LE   +  +L+ L F   +G  C  CI
Sbjct: 309 LAPGSRVVTKYLEASGLLPYLEKLGFH-VVGYGCTTCI 345


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.337    0.152    0.487 

Gapped
Lambda     K      H
   0.267   0.0594    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 543,125
Number of extensions: 17687
Number of successful extensions: 73
Number of sequences better than 10.0: 1
Number of HSP's gapped: 73
Number of HSP's successfully gapped: 3
Length of query: 45
Length of database: 6,263,737
Length adjustment: 18
Effective length of query: 27
Effective length of database: 5,874,775
Effective search space: 158618925
Effective search space used: 158618925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 51 (23.7 bits)