Query 537021.9.peg.26_1 Match_columns 49 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 22 17:55:07 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_26.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK13683 hypothetical protein; 30.2 16 0.00041 18.7 0.2 25 6-30 11-43 (88) 2 COG3397 Uncharacterized protei 22.1 48 0.0012 16.4 1.4 25 14-41 128-152 (308) 3 pfam05107 DUF694 Family of unk 20.6 63 0.0016 15.8 1.8 32 13-44 3-36 (278) 4 TIGR00972 3a0107s01c2 phosphat 16.9 45 0.0012 16.5 0.4 10 4-13 90-99 (248) 5 TIGR01684 viral_ppase viral ph 14.9 91 0.0023 15.0 1.5 27 11-37 198-224 (323) 6 COG1777 Predicted transcriptio 14.6 59 0.0015 15.9 0.5 13 11-23 68-80 (217) 7 pfam03067 Chitin_bind_3 Chitin 12.0 1.2E+02 0.003 14.4 1.4 30 5-34 87-118 (180) 8 pfam08909 DUF1854 Domain of un 10.5 1.1E+02 0.0029 14.5 0.9 16 6-21 10-25 (133) 9 pfam01065 Adeno_hexon Hexon, a 7.7 89 0.0023 15.1 -0.6 14 6-19 466-479 (487) 10 COG2524 Predicted transcriptio 7.7 1.4E+02 0.0034 14.2 0.3 36 10-45 167-204 (294) No 1 >PRK13683 hypothetical protein; Provisional Probab=30.20 E-value=16 Score=18.70 Aligned_cols=25 Identities=32% Similarity=0.529 Sum_probs=16.9 Q ss_pred CCCCCCCCCCE--------EEEEEECCCCCCCC Q ss_conf 34442242101--------11101135788862 Q 537021.9.peg.2 6 IPFPISIPRKY--------FHILISKKNKNPNA 30 (49) Q Consensus 6 ipfpisiprky--------fhiliskknknpna 30 (49) -|||+|+-||- -.|.-+-+.-||+- T Consensus 11 sP~PiSVQrKe~edA~~lYq~I~~am~~g~p~l 43 (88) T PRK13683 11 SPMPVSVQRKEAEDAEALYQQIRQAMRSGNPRL 43 (88) T ss_pred CCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCE T ss_conf 876238885258899999999999986699856 No 2 >COG3397 Uncharacterized protein conserved in bacteria [Function unknown] Probab=22.09 E-value=48 Score=16.37 Aligned_cols=25 Identities=36% Similarity=0.546 Sum_probs=20.9 Q ss_pred CCEEEEEEECCCCCCCCCHHHHHCCHHH Q ss_conf 1011110113578886200132100011 Q 537021.9.peg.2 14 RKYFHILISKKNKNPNASLTKKKRSDSE 41 (49) Q Consensus 14 rkyfhiliskknknpnasltkkkrsdse 41 (49) -.|+|..|+|.+-|||.-|+ |+|-| T Consensus 128 t~~w~yYiTK~~wdpnkPLt---~~dlE 152 (308) T COG3397 128 TAYWKYYITKPGWDPNKPLT---WDDLE 152 (308) T ss_pred CCCEEEEECCCCCCCCCCCC---HHHCC T ss_conf 73047998778889788856---77635 No 3 >pfam05107 DUF694 Family of unknown function (DUF694). Family of hypothetical bacterial proteins. Probab=20.65 E-value=63 Score=15.77 Aligned_cols=32 Identities=38% Similarity=0.483 Sum_probs=23.5 Q ss_pred CCCEEEEEEECCCCCCCCCHH--HHHCCHHHCCC Q ss_conf 210111101135788862001--32100011063 Q 537021.9.peg.2 13 PRKYFHILISKKNKNPNASLT--KKKRSDSEKGI 44 (49) Q Consensus 13 prkyfhiliskknknpnaslt--kkkrsdsekgi 44 (49) -|..|-.|+.-++-|||.--. .+-|-|.|.|. T Consensus 3 nr~efl~l~dv~~~NPNGDP~~~N~PR~d~etg~ 36 (278) T pfam05107 3 NRYEFLFLYDVKNGNPNGDPLNGNRPRIDPETGT 36 (278) T ss_pred CEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCC T ss_conf 5168999999547889999778999987877792 No 4 >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670 This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane. Probab=16.94 E-value=45 Score=16.48 Aligned_cols=10 Identities=60% Similarity=1.015 Sum_probs=7.3 Q ss_pred CCCCCCCCCC Q ss_conf 7634442242 Q 537021.9.peg.2 4 IPIPFPISIP 13 (49) Q Consensus 4 ipipfpisip 13 (49) -|=|||.||= T Consensus 90 ~PNPFpmSIy 99 (248) T TIGR00972 90 KPNPFPMSIY 99 (248) T ss_pred CCCCCCCCHH T ss_conf 7897884055 No 5 >TIGR01684 viral_ppase viral phosphatase; InterPro: IPR007827 This family contains uncharacterised baculoviral proteins.. Probab=14.86 E-value=91 Score=15.01 Aligned_cols=27 Identities=30% Similarity=0.548 Sum_probs=19.9 Q ss_pred CCCCCEEEEEEECCCCCCCCCHHHHHC Q ss_conf 242101111011357888620013210 Q 537021.9.peg.2 11 SIPRKYFHILISKKNKNPNASLTKKKR 37 (49) Q Consensus 11 siprkyfhiliskknknpnasltkkkr 37 (49) .|-+.||||.||.-+|.-.++.....| T Consensus 198 kl~~RYFd~i~~gG~~~~~~~~~~t~~ 224 (323) T TIGR01684 198 KLDRRYFDIILSGGHKAEEYSTASTER 224 (323) T ss_pred CCCCCEEEEEECCCCCCCCCCCCCCCE T ss_conf 777512458981782025578864220 No 6 >COG1777 Predicted transcriptional regulators [Transcription] Probab=14.61 E-value=59 Score=15.94 Aligned_cols=13 Identities=38% Similarity=0.600 Sum_probs=8.5 Q ss_pred CCCCCEEEEEEEC Q ss_conf 2421011110113 Q 537021.9.peg.2 11 SIPRKYFHILISK 23 (49) Q Consensus 11 siprkyfhilisk 23 (49) .-|||||+|-... T Consensus 68 g~~rKYY~Is~~~ 80 (217) T COG1777 68 GRPRKYYMISRNL 80 (217) T ss_pred CCCCCEEECCCCE T ss_conf 8876226506770 No 7 >pfam03067 Chitin_bind_3 Chitin binding domain. This domain is found associated with a wide variety of cellulose binding domain. This domain however is a chitin binding domain. This domain is found in isolation in baculoviral spheroidins and spindolins, protein of unknown function. Probab=11.98 E-value=1.2e+02 Score=14.43 Aligned_cols=30 Identities=30% Similarity=0.550 Sum_probs=22.4 Q ss_pred CCCCCCCCCC--CEEEEEEECCCCCCCCCHHH Q ss_conf 6344422421--01111011357888620013 Q 537021.9.peg.2 5 PIPFPISIPR--KYFHILISKKNKNPNASLTK 34 (49) Q Consensus 5 pipfpisipr--kyfhiliskknknpnasltk 34 (49) .+-|-++.|. .||...|+|.+-+|+..||. T Consensus 87 ~f~~~~TA~H~t~~~~~yITk~g~dp~~~Ltw 118 (180) T pfam03067 87 TFTWTATAPHKTSYFEYYITKPGWDPNQPLTW 118 (180) T ss_pred EEEEEEEEECCCCEEEEEECCCCCCCCCCCCH T ss_conf 89997553037875899976689898997677 No 8 >pfam08909 DUF1854 Domain of unknown function (DUF1854). This potential domain is functionally uncharacterized. It is found at the C-terminus of a number of ATP transporter proteins suggesting this domain may be involved in ligand binding. Probab=10.48 E-value=1.1e+02 Score=14.53 Aligned_cols=16 Identities=25% Similarity=0.486 Sum_probs=12.7 Q ss_pred CCCCCCCCCCEEEEEE Q ss_conf 3444224210111101 Q 537021.9.peg.2 6 IPFPISIPRKYFHILI 21 (49) Q Consensus 6 ipfpisiprkyfhili 21 (49) -.|||+-|..|+-+.- T Consensus 10 raFPisaP~~~isl~~ 25 (133) T pfam08909 10 RAFPITAPDEGISLVD 25 (133) T ss_pred EECCCCCCCCCEEEEC T ss_conf 7556537877569986 No 9 >pfam01065 Adeno_hexon Hexon, adenovirus major coat protein, N-terminal domain. Hexon is the major coat protein from adenovirus type 2. Hexon forms a homo-trimer. The 240 copies of the hexon trimer are organized so that 12 lie on each of the 20 facets. The central 9 hexons in a facet are cemented together by 12 copies of polypeptide IX. The penton complex, formed by the peripentonal hexons and base hexon (holding in place a fibre), lie at each of the 12 vertices. The N and C-terminal domains adopt the same PNGase F-like fold although they are significantly different in length. Probab=7.66 E-value=89 Score=15.07 Aligned_cols=14 Identities=43% Similarity=0.930 Sum_probs=0.0 Q ss_pred CCCCCCCCCCEEEE Q ss_conf 34442242101111 Q 537021.9.peg.2 6 IPFPISIPRKYFHI 19 (49) Q Consensus 6 ipfpisiprkyfhi 19 (49) .+|-|.+|.|+|-| T Consensus 466 ~~FhIQVPQKFFAI 479 (487) T pfam01065 466 CKFHIQVPQKFFAI 479 (487) T ss_pred EEEEEECCHHHHHH T ss_conf 00477034488777 No 10 >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Probab=7.65 E-value=1.4e+02 Score=14.17 Aligned_cols=36 Identities=36% Similarity=0.540 Sum_probs=0.0 Q ss_pred CCCCCCEEEEEEECC--CCCCCCCHHHHHCCHHHCCCC Q ss_conf 224210111101135--788862001321000110631 Q 537021.9.peg.2 10 ISIPRKYFHILISKK--NKNPNASLTKKKRSDSEKGIH 45 (49) Q Consensus 10 isiprkyfhiliskk--nknpnasltkkkrsdsekgih 45 (49) +|||++-.+-++|++ --+|+.|+..--+--.|+||+ T Consensus 167 ~siPk~~V~~~~s~~~i~v~~d~tl~eaak~f~~~~i~ 204 (294) T COG2524 167 VSIPKEKVKNLMSKKLITVRPDDTLREAAKLFYEKGIR 204 (294) T ss_pred EECCCCHHHHHCCCCCEEECCCCCHHHHHHHHHHCCCC T ss_conf 64573026662667846766886399999999972866 Done!