Query 537021.9.peg.298_1 Match_columns 38 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 16:10:51 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_298.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam05372 Delta_lysin Delta ly 26.6 53 0.0013 16.0 2.3 17 1-17 1-17 (26) 2 pfam03248 Rer1 Rer1 family. RE 17.5 38 0.00096 16.7 0.1 16 9-24 151-166 (175) 3 KOG3379 consensus 13.8 98 0.0025 14.6 1.4 24 3-26 60-83 (150) 4 pfam10251 PEN-2 Presenilin enh 13.6 1.3E+02 0.0033 14.0 2.3 16 13-29 45-60 (94) 5 pfam07867 DUF1654 Protein of u 11.4 1.5E+02 0.0039 13.7 1.8 15 5-19 4-19 (73) 6 PRK09343 prefoldin subunit bet 9.0 1.9E+02 0.0049 13.2 2.0 26 4-33 55-80 (122) 7 TIGR00692 tdh L-threonine 3-de 7.9 2.1E+02 0.0053 13.0 1.4 16 13-28 288-303 (341) 8 KOG0871 consensus 7.7 1.9E+02 0.0048 13.2 1.1 11 9-19 15-25 (156) 9 pfam04912 Dynamitin Dynamitin. 7.3 2.3E+02 0.0059 12.8 3.9 30 3-32 297-326 (387) 10 KOG1688 consensus 7.1 1.6E+02 0.004 13.6 0.4 15 10-24 162-176 (188) No 1 >pfam05372 Delta_lysin Delta lysin family. Delta-lysin is a 26 amino acid, hemolytic peptide toxin secreted by Staphylococcus aureus. It is thought that delta-toxin forms an amphipathic helix upon binding to lipid bilayers. The precise mode of action of delta-lysis is unclear. Probab=26.57 E-value=53 Score=15.96 Aligned_cols=17 Identities=47% Similarity=0.655 Sum_probs=13.6 Q ss_pred CCHHHHHHHHHHHHHHH Q ss_conf 90479999999999987 Q 537021.9.peg.2 1 MAHDLYETIGTIQKMIK 17 (38) Q Consensus 1 mahdlyetigtiqkmik 17 (38) ||.|.-.|||..-|.|- T Consensus 1 Ma~DIisTI~dfvKlI~ 17 (26) T pfam05372 1 MAADIISTIGDFVKLII 17 (26) T ss_pred CCHHHHHHHHHHHHHHH T ss_conf 90789999999999999 No 2 >pfam03248 Rer1 Rer1 family. RER1 family protein are involved in involved in the retrieval of some endoplasmic reticulum membrane proteins from the early golgi compartment. The C terminus of yeast Rer1p interacts with a coatomer complex. Probab=17.53 E-value=38 Score=16.68 Aligned_cols=16 Identities=44% Similarity=0.472 Sum_probs=11.5 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9999999877999999 Q 537021.9.peg.2 9 IGTIQKMIKTKYVVSS 24 (38) Q Consensus 9 igtiqkmiktkyvvss 24 (38) ...||.|||-||+--+ T Consensus 151 krqI~HMiKYrYvPf~ 166 (175) T pfam03248 151 RRQIKHMIKYKYVPFD 166 (175) T ss_pred HHHHHHHHHHCCCCCC T ss_conf 9999999854876642 No 3 >KOG3379 consensus Probab=13.83 E-value=98 Score=14.63 Aligned_cols=24 Identities=29% Similarity=0.628 Sum_probs=20.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 479999999999987799999999 Q 537021.9.peg.2 3 HDLYETIGTIQKMIKTKYVVSSLI 26 (38) Q Consensus 3 hdlyetigtiqkmiktkyvvssli 26 (38) .||+.|.--+|++++.-|-.+|+- T Consensus 60 aDlF~t~~~v~~~lek~~~~ts~t 83 (150) T KOG3379 60 ADLFTTVQKVQRVLEKHYNATSLT 83 (150) T ss_pred HHHHHHHHHHHHHHHHHHCCCCEE T ss_conf 999999999999999982666158 No 4 >pfam10251 PEN-2 Presenilin enhancer-2 subunit of gamma secretase. This entry is a short 101 peptide protein which is the smallest subunit of the gamma-secretase aspartyl protease complex that catalyses the intramembrane cleavage of a subset of type I transmembrane proteins. The other active constituents of the complex are presenilin (PS) nicastrin and anterior pharynx defective-1 (APH-1) protein. PEN-2 adopts a hairpin orientation in the membrane with its N- and C-terminal domains facing the luminal/extracellular space, and the C-terminal domain maintains PS stability within the complex. Probab=13.64 E-value=1.3e+02 Score=14.02 Aligned_cols=16 Identities=56% Similarity=0.708 Sum_probs=11.3 Q ss_pred HHHHHHHHHHHHHHHHH Q ss_conf 99987799999999977 Q 537021.9.peg.2 13 QKMIKTKYVVSSLIKSL 29 (38) Q Consensus 13 qkmiktkyvvssliksl 29 (38) |+-|| +||+-|.|-.+ T Consensus 45 q~~Ir-~YVi~SaIG~~ 60 (94) T pfam10251 45 QKQIR-KYVIRSAIGFL 60 (94) T ss_pred CHHHH-HHHHHHHHHHH T ss_conf 07999-99999999899 No 5 >pfam07867 DUF1654 Protein of unknown function (DUF1654). This family consists of proteins from the Pseudomonadaceae. Probab=11.39 E-value=1.5e+02 Score=13.68 Aligned_cols=15 Identities=47% Similarity=0.804 Sum_probs=10.4 Q ss_pred HHHHHHH-HHHHHHHH Q ss_conf 9999999-99998779 Q 537021.9.peg.2 5 LYETIGT-IQKMIKTK 19 (38) Q Consensus 5 lyetigt-iqkmiktk 19 (38) -||.+|. ||+||... T Consensus 4 ~~e~Lg~Rvq~~InsP 19 (73) T pfam07867 4 SYERLGLRVQKMINSP 19 (73) T ss_pred HHHHHHHHHHHHHCCH T ss_conf 8999999999997695 No 6 >PRK09343 prefoldin subunit beta; Provisional Probab=8.98 E-value=1.9e+02 Score=13.19 Aligned_cols=26 Identities=35% Similarity=0.685 Sum_probs=16.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 799999999999877999999999775333 Q 537021.9.peg.2 4 DLYETIGTIQKMIKTKYVVSSLIKSLNEVK 33 (38) Q Consensus 4 dlyetigtiqkmiktkyvvsslikslnevk 33 (38) .+|..+|++ |||+.+ ..+++.|+|-+ T Consensus 55 ~vYK~VG~v--Lik~~k--~~~~~eL~ekk 80 (122) T PRK09343 55 PVYKTVGNL--LVKVDK--NKVIKELKEQK 80 (122) T ss_pred HHHHHHCHH--HEECCH--HHHHHHHHHHH T ss_conf 799983566--402349--99999999999 No 7 >TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1.1.1.103 from EC) is a tetrameric, zinc-binding, NAD-dependent enzyme of threonine catabolism. It catalyses the conversion of L-threonine and NAD+ to L-2-amino-3-oxobutanoate and NADH. In Escherichia coli His-90 modulates substrate specificity and is believed part of the active site. Closely related proteins include sorbitol dehydrogenase, xylitol dehydrogenase, and benzyl alcohol dehydrogenase. Eukaryotic examples of this enzyme have been demonstrated experimentally but are not detected by this HMM. ; GO: 0008270 zinc ion binding, 0008743 L-threonine 3-dehydrogenase activity, 0006567 threonine catabolic process. Probab=7.88 E-value=2.1e+02 Score=13.04 Aligned_cols=16 Identities=56% Similarity=0.696 Sum_probs=14.6 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 9998779999999997 Q 537021.9.peg.2 13 QKMIKTKYVVSSLIKS 28 (38) Q Consensus 13 qkmiktkyvvssliks 28 (38) .+|..|=|-||.||.| T Consensus 288 R~mfeTWy~vs~LiqS 303 (341) T TIGR00692 288 RKMFETWYKVSRLIQS 303 (341) T ss_pred CCHHHHHHHHHHHHCC T ss_conf 5046789999998426 No 8 >KOG0871 consensus Probab=7.73 E-value=1.9e+02 Score=13.23 Aligned_cols=11 Identities=45% Similarity=0.543 Sum_probs=7.4 Q ss_pred HHHHHHHHHHH Q ss_conf 99999998779 Q 537021.9.peg.2 9 IGTIQKMIKTK 19 (38) Q Consensus 9 igtiqkmiktk 19 (38) -.||+||||.- T Consensus 15 kAtv~KmIke~ 25 (156) T KOG0871 15 KATVNKMIKEM 25 (156) T ss_pred HHHHHHHHHHH T ss_conf 88899999986 No 9 >pfam04912 Dynamitin Dynamitin. Dynamitin is a subunit of the microtubule-dependent motor complex and in implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS). Probab=7.28 E-value=2.3e+02 Score=12.79 Aligned_cols=30 Identities=17% Similarity=0.279 Sum_probs=18.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 479999999999987799999999977533 Q 537021.9.peg.2 3 HDLYETIGTIQKMIKTKYVVSSLIKSLNEV 32 (38) Q Consensus 3 hdlyetigtiqkmiktkyvvsslikslnev 32 (38) +.||+++.+|+.|-..---|-.-.++|+.+ T Consensus 297 ~eLY~~l~~~~~~~~~LP~vl~RL~sL~~l 326 (387) T pfam04912 297 SELYELMQKWDPVVSSLPDVVNRLLTLKSL 326 (387) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 999999875777763515899999999999 No 10 >KOG1688 consensus Probab=7.10 E-value=1.6e+02 Score=13.65 Aligned_cols=15 Identities=33% Similarity=0.501 Sum_probs=10.3 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 999999877999999 Q 537021.9.peg.2 10 GTIQKMIKTKYVVSS 24 (38) Q Consensus 10 gtiqkmiktkyvvss 24 (38) -.||.|||-+|+--+ T Consensus 162 RqI~HMiKyrY~Pf~ 176 (188) T KOG1688 162 RQIAHMIKYRYIPFD 176 (188) T ss_pred HHHHHHHHHCCCCCC T ss_conf 999998861335401 Done!