>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a.) putative phenylalanine biosynthetic pathway protein described in Bacillus subtilis (BS) PheB (PheB-BS) and related domains. This CD includes the C-terminal ACT domain of a small (~147 a.a.) putative phenylalanine biosynthetic pathway protein described in Bacillus subtilis (BS) PheB (PheB-BS) and other related ACT domains. In B. subtilis, the upstream gene of pheB, pheA encodes prephenate dehydratase (PDT). The presumed product of the pheB gene is chorismate mutase (CM). The deduced product of the B. subtilis pheB gene, however, has no significant homology to the CM portion of the bifunctional CM-PDT of Escherichia coli. The presence of an ACT domain lends support to the prediction that these proteins function as a phenylalanine-binding regulatory protein. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=98.11 E-value=3e-05 Score=48.56 Aligned_cols=70 Identities=17% Similarity=0.155 Sum_probs=57.6 Q ss_pred EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCC----CHHHHHHHHCCCCEEEEEEE Q ss_conf 999998287866889998997369963227742147898189999947889----98999998649882999999 Q 537021.9.peg.3 25 MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI----LNSVLEKLSVNVTIRFVKQF 95 (100) Q Consensus 25 ~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i----~~~vl~~i~~~~~v~~vr~i 95 (100) T Consensus 2 Tl~l~l~d~~G~LS~vL~~ia~~~~NILTInQsIP-i~g~A~vtiS~d~s~~~~~i~~ll~~l~~i~gV~~vei~ 75 (76) T cd04888 2 TLSLLLEHRPGVLSKVLNTIAQVRGNVLTINQNIP-IHGRANVTISIDTSTMNGDIDELLEELREIDGVEKVELV 75 (76) T ss_pred EEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCC-CCCEEEEEEEEEECCCCCCHHHHHHHHHCCCCEEEEEEE T ss_conf 89999828875399999999976983999647887-688899999999047766899999998707992799971

HHsearch alignment for GI: peg_33 and conserved domain: cd04888