BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.34_1 (208 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.34_1 Length = 208 Score = 422 bits (1086), Expect = e-120, Method: Compositional matrix adjust. Identities = 208/208 (100%), Positives = 208/208 (100%) Query: 1 LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60 LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV Sbjct: 1 LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60 Query: 61 EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120 EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE Sbjct: 61 EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120 Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV Sbjct: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180 Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208 GANIISAPIIIKENAIILSTIKRDKSGV Sbjct: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 24.6 bits (52), Expect = 1.5, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 12/14 (85%) Query: 46 QSGHVAEAGFDVFE 59 QSGH+ E GF++++ Sbjct: 988 QSGHIREIGFELYQ 1001 >gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Score = 22.7 bits (47), Expect = 4.6, Method: Compositional matrix adjust. Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 119 FEEAPLVKPFMTLADHLGCFIGQ-LISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177 F +P++ F+ L ++G + Q I I + + + V+NS + G V V Sbjct: 46 FRVSPILPLFVLLVANIGTWFTQNPIFPMWSLITLAVYAANLSLGKKVMNSDIKIGEVYV 105 Query: 178 WRV 180 WR+ Sbjct: 106 WRI 108 >gi|254780591|ref|YP_003065004.1| aminomethyltransferase protein (glycine cleavage) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 22.7 bits (47), Expect = 4.8, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 136 GCFIGQLISESIQEIQII 153 GC+IGQ + IQ II Sbjct: 183 GCYIGQEVVSRIQHRNII 200 >gi|254780617|ref|YP_003065030.1| F0F1 ATP synthase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 509 Score = 22.7 bits (47), Expect = 5.0, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 20/45 (44%) Query: 111 ALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYD 155 AL+ +I+ A P LA GC +G+ ++ I YD Sbjct: 225 ALSYSIVVVASASDPAPMQLLAPFAGCAMGEYFRDNGYHALIAYD 269 >gi|254781145|ref|YP_003065558.1| hypothetical protein CLIBASIA_05245 [Candidatus Liberibacter asiaticus str. psy62] Length = 350 Score = 22.3 bits (46), Expect = 6.1, Method: Compositional matrix adjust. Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 137 CFIGQLISESIQEIQII 153 CFIG+ ++ SI EIQ I Sbjct: 176 CFIGESLAASIIEIQKI 192 >gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Score = 22.3 bits (46), Expect = 6.6, Method: Compositional matrix adjust. Identities = 10/34 (29%), Positives = 17/34 (50%) Query: 71 LPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLI 104 L N + ST + EK + L+H SD+++ Sbjct: 230 LTNGLAIATIADSTFHNDEKTSPNLSHNSSDHIL 263 >gi|254781170|ref|YP_003065583.1| deoxyribodipyrimidine photolyase [Candidatus Liberibacter asiaticus str. psy62] Length = 483 Score = 21.6 bits (44), Expect = 9.9, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 85 VESQEKVAIQLAHQMSDYLIDGVVS 109 VE ++ AIQ Q+S YL GV+S Sbjct: 231 VEQRDIPAIQGTSQLSPYLSIGVLS 255 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.135 0.382 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 119,804 Number of Sequences: 1233 Number of extensions: 4312 Number of successful extensions: 19 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 9 length of query: 208 length of database: 328,796 effective HSP length: 70 effective length of query: 138 effective length of database: 242,486 effective search space: 33463068 effective search space used: 33463068 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)