Query 537021.9.peg.360_1 Match_columns 52 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 03:35:25 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_360.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00708 cobA cob(I)alamin ad 13.9 54 0.0014 16.8 0.1 17 23-39 114-130 (191) 2 COG4268 McrC McrBC 5-methylcyt 12.5 64 0.0016 16.5 0.1 23 29-51 257-279 (439) 3 pfam08412 Ion_trans_N Ion tran 11.4 60 0.0015 16.6 -0.3 21 8-28 33-53 (77) 4 PRK11561 isovaleryl CoA dehydr 10.6 1.3E+02 0.0034 15.0 1.3 16 35-50 208-223 (538) 5 COG5271 MDN1 AAA ATPase contai 9.5 1.1E+02 0.0028 15.4 0.5 28 18-47 43-70 (4600) 6 COG2152 Predicted glycosylase 8.0 1.7E+02 0.0044 14.5 1.0 19 32-50 274-292 (314) 7 pfam04507 DUF576 Protein of un 7.6 1.7E+02 0.0045 14.4 0.9 10 40-49 156-165 (257) 8 pfam10828 DUF2570 Protein of u 7.2 1.4E+02 0.0035 14.9 0.2 22 11-34 11-32 (110) 9 PRK11538 hypothetical protein; 5.7 1.9E+02 0.0048 14.3 0.2 19 9-27 82-101 (105) 10 pfam11872 DUF3392 Protein of u 5.5 1.7E+02 0.0043 14.5 -0.1 11 31-41 26-36 (106) No 1 >TIGR00708 cobA cob(I)alamin adenosyltransferase; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2.5.1.17 from EC), catalyse the conversion of cobalamin (vitamin B12) into its coenzyme form, adenosylcobalamin (coenzyme B12) . Adenosylcobalamin (AdoCbl) is required for the ativity of certain enzymes. AdoCbl contains an adenosyl moiety liganded to the cobalt ion of cobalamin via a covalent Co-C bond, and its synthesis is unique to certain prokaryotes. ATP:cob(I)alamin adenosyltransferases are classed into three groups: CobA-type , EutT-type and PduO-type . Each of the three enzyme types appears to be specialised for particular AdoCbl-dependent enzymes or for the de novo synthesis AdoCbl. PduO and EutT are distantly related, sharing short conserved motifs, while CobA is evolutionarily unrelated and is an example of convergent evolution. This entry represnts the ATP:cob(I)alamin adenosyltransferases CobA (Salmonella typhimurium), CobO (Pseudomonas denitrificans), and ButR (Escherichia coli). There is a high degree of sequence identity between these proteins . CobA is responsible for attaching the adenosyl moiety from ATP to the cobalt ion of the corrin ring, necessary for the convertion of cobalamin to adenosylcobalamin , . ; GO: 0005524 ATP binding, 0008817 cob(I)yrinic acid ac-diamide adenosyltransferase activity, 0009236 cobalamin biosynthetic process. Probab=13.95 E-value=54 Score=16.82 Aligned_cols=17 Identities=41% Similarity=0.718 Sum_probs=14.3 Q ss_pred HEEHHHHHHHHHHHHEE Q ss_conf 21211274431021050 Q 537021.9.peg.3 23 YYQLNLIDELCCLVLYG 39 (52) Q Consensus 23 yyqlnlidelcclvlyg 39 (52) -|||-|.||+|-.+-|| T Consensus 114 ~~dlvLLDE~~~~l~~G 130 (191) T TIGR00708 114 EYDLVLLDELTVALKFG 130 (191) T ss_pred CCCEEEHHHHHHHHHCC T ss_conf 87764034234555348 No 2 >COG4268 McrC McrBC 5-methylcytosine restriction system component [Defense mechanisms] Probab=12.50 E-value=64 Score=16.49 Aligned_cols=23 Identities=26% Similarity=0.299 Sum_probs=18.7 Q ss_pred HHHHHHHHHEEEEEEEEECCCCC Q ss_conf 74431021050274266056446 Q 537021.9.peg.3 29 IDELCCLVLYGEKFFVSYGNAGA 51 (52) Q Consensus 29 idelcclvlygekffvsygnaga 51 (52) .-++||++|+++++-..+|..-| T Consensus 257 l~~~C~mIL~n~~p~~~~g~~ka 279 (439) T COG4268 257 LIALCKMILNNESPGQNKGDYKA 279 (439) T ss_pred HHHHHHHHHCCCCCCCCCCCHHH T ss_conf 99999999838785535442013 No 3 >pfam08412 Ion_trans_N Ion transport protein N-terminal. This metazoan domain is found to the N-terminus of pfam00520 in voltage- and cyclic nucleotide-gated K/Na ion channels. Probab=11.36 E-value=60 Score=16.61 Aligned_cols=21 Identities=33% Similarity=0.726 Sum_probs=17.5 Q ss_pred CCCEEHHEHHHHHHHHEEHHH Q ss_conf 474021031223012212112 Q 537021.9.peg.3 8 KSGAVIVHFFSKVWFYYQLNL 28 (52) Q Consensus 8 ksgavivhffskvwfyyqlnl 28 (52) ++|.-|.|-||.--|||.+-+ T Consensus 33 ~~G~wiIHP~S~FRfYWdl~m 53 (77) T pfam08412 33 SAGVWIIHPYSDFRFYWDLCM 53 (77) T ss_pred HCCCEEECCCCCHHHHHHHHH T ss_conf 549748756611499999999 No 4 >PRK11561 isovaleryl CoA dehydrogenase; Provisional Probab=10.64 E-value=1.3e+02 Score=14.99 Aligned_cols=16 Identities=31% Similarity=0.484 Sum_probs=12.1 Q ss_pred HHHEEEEEEEEECCCC Q ss_conf 2105027426605644 Q 537021.9.peg.3 35 LVLYGEKFFVSYGNAG 50 (52) Q Consensus 35 lvlygekffvsygnag 50 (52) -.|+|.|+|.|.+.+. T Consensus 208 YrL~G~KwF~Sa~~~D 223 (538) T PRK11561 208 YRLVGHKWFFSVPQSD 223 (538) T ss_pred EEEEEEEEEECCCCCH T ss_conf 9999998885155500 No 5 >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Probab=9.47 E-value=1.1e+02 Score=15.36 Aligned_cols=28 Identities=43% Similarity=0.895 Sum_probs=22.4 Q ss_pred HHHHHHEEHHHHHHHHHHHHEEEEEEEEEC Q ss_conf 230122121127443102105027426605 Q 537021.9.peg.3 18 SKVWFYYQLNLIDELCCLVLYGEKFFVSYG 47 (52) Q Consensus 18 skvwfyyqlnlidelcclvlygekffvsyg 47 (52) -+|||.|.+|-|-|-|-.-.|||. ..|| T Consensus 43 ~~v~~ly~~dei~et~k~k~~get--~~y~ 70 (4600) T COG5271 43 YDVWFLYASDEIRETCKVKYYGET--KTYG 70 (4600) T ss_pred HHHHHHHHHHHHHHHHHHEECCCC--CCEE T ss_conf 467767655889987656012455--4001 No 6 >COG2152 Predicted glycosylase [Carbohydrate transport and metabolism] Probab=7.98 E-value=1.7e+02 Score=14.45 Aligned_cols=19 Identities=37% Similarity=0.801 Sum_probs=16.8 Q ss_pred HHHHHHEEEEEEEEECCCC Q ss_conf 3102105027426605644 Q 537021.9.peg.3 32 LCCLVLYGEKFFVSYGNAG 50 (52) Q Consensus 32 lcclvlygekffvsygnag 50 (52) .|-++++|.+..++||.|. T Consensus 274 ~CG~v~~~~~l~iyYGaAD 292 (314) T COG2152 274 PCGAVLLGDELLIYYGAAD 292 (314) T ss_pred ECCEEEECCEEEEEEECCC T ss_conf 2126997998999950265 No 7 >pfam04507 DUF576 Protein of unknown function, DUF576. This family contains several uncharacterized staphylococcal proteins. Probab=7.55 E-value=1.7e+02 Score=14.42 Aligned_cols=10 Identities=70% Similarity=1.092 Sum_probs=7.2 Q ss_pred EEEEEEECCC Q ss_conf 2742660564 Q 537021.9.peg.3 40 EKFFVSYGNA 49 (52) Q Consensus 40 ekffvsygna 49 (52) -|||+.|||- T Consensus 156 FKFF~QYgnF 165 (257) T pfam04507 156 FKFFVQYGNF 165 (257) T ss_pred CEEEEEECCC T ss_conf 3322421263 No 8 >pfam10828 DUF2570 Protein of unknown function (DUF2570). This is a family of proteins with unknown function. Probab=7.25 E-value=1.4e+02 Score=14.94 Aligned_cols=22 Identities=36% Similarity=0.605 Sum_probs=15.4 Q ss_pred EEHHEHHHHHHHHEEHHHHHHHHH Q ss_conf 021031223012212112744310 Q 537021.9.peg.3 11 AVIVHFFSKVWFYYQLNLIDELCC 34 (52) Q Consensus 11 avivhffskvwfyyqlnlidelcc 34 (52) ++|+-. -+|..||-+-||.|-. T Consensus 11 ~lilgL--~gwlw~QS~~Id~LrA 32 (110) T pfam10828 11 ALILGL--GGWSWYQSQKIDSLRA 32 (110) T ss_pred HHHHHH--HHHHHHHHHHHHHHHH T ss_conf 999999--9999999888899998 No 9 >PRK11538 hypothetical protein; Provisional Probab=5.67 E-value=1.9e+02 Score=14.27 Aligned_cols=19 Identities=37% Similarity=0.574 Sum_probs=12.8 Q ss_pred CCEEHHEHHHH-HHHHEEHH Q ss_conf 74021031223-01221211 Q 537021.9.peg.3 9 SGAVIVHFFSK-VWFYYQLN 27 (52) Q Consensus 9 sgavivhffsk-vwfyyqln 27 (52) -|.||||.|++ .--||+|. T Consensus 82 ~gdvvVHif~~e~R~~Y~LE 101 (105) T PRK11538 82 LGDVIVHVMQEESRRLYELE 101 (105) T ss_pred CCCEEEECCCHHHHHHCCHH T ss_conf 78589992787886672575 No 10 >pfam11872 DUF3392 Protein of unknown function (DUF3392). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length. Probab=5.54 E-value=1.7e+02 Score=14.51 Aligned_cols=11 Identities=36% Similarity=0.939 Sum_probs=8.5 Q ss_pred HHHHHHHEEEE Q ss_conf 43102105027 Q 537021.9.peg.3 31 ELCCLVLYGEK 41 (52) Q Consensus 31 elcclvlygek 41 (52) --||||+||.. T Consensus 26 vAclLVv~G~~ 36 (106) T pfam11872 26 VACLLVVFGDD 36 (106) T ss_pred HHHHHHHHHHH T ss_conf 99999997298 Done!