BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.360_1 (52 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.360_1 Length = 52 Score = 105 bits (263), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 52/52 (100%), Positives = 52/52 (100%) Query: 1 LYLGARFKSGAVIVHFFSKVWFYYQLNLIDELCCLVLYGEKFFVSYGNAGAI 52 LYLGARFKSGAVIVHFFSKVWFYYQLNLIDELCCLVLYGEKFFVSYGNAGAI Sbjct: 1 LYLGARFKSGAVIVHFFSKVWFYYQLNLIDELCCLVLYGEKFFVSYGNAGAI 52 >gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Score = 19.6 bits (39), Expect = 8.8, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 4 GARFKSGAVIVHFFSKVWFYYQLNLID 30 G K+ V +++ S YQLNLID Sbjct: 58 GITIKAQTVRLNYTSTDAKDYQLNLID 84 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.150 0.493 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,951 Number of Sequences: 1233 Number of extensions: 1052 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 52 length of database: 328,796 effective HSP length: 25 effective length of query: 27 effective length of database: 297,971 effective search space: 8045217 effective search space used: 8045217 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 31 (16.5 bits)