RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.363_1 (79 letters) >gnl|CDD|114410 pfam05684, DUF819, Protein of unknown function (DUF819). This family contains proteins of unknown function from archaeal, bacterial and plant species. Length = 379 Score = 27.0 bits (60), Expect = 1.3 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Query: 1 MNSLRGIRPSNLSPTSTTTVSFSRPTTIPLVTQFSARSFLVKLSSRRVAKSSR 53 N++ I + SP +F P IPL+ L+++ R++ K Sbjct: 38 FNTVGLIDSESESPAYDVVRNFLLPAAIPLL--------LLRIDLRKIIKLGG 82 >gnl|CDD|32271 COG2088, SpoVG, Uncharacterized protein, involved in the regulation of septum location [Cell envelope biogenesis, outer membrane]. Length = 95 Score = 24.9 bits (54), Expect = 5.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Query: 41 VKLSSRRVAKSSRDGLVKDINTPDKQQTKNPITSSV 76 V + SRR + DG +DI P T+ I +V Sbjct: 45 VAMPSRR----TPDGEFRDIAHPINSDTREKIQDAV 76 >gnl|CDD|37665 KOG2454, KOG2454, KOG2454, Betaine aldehyde dehydrogenase [Energy production and conversion]. Length = 583 Score = 24.2 bits (52), Expect = 8.0 Identities = 12/37 (32%), Positives = 13/37 (35%) Query: 2 NSLRGIRPSNLSPTSTTTVSFSRPTTIPLVTQFSARS 38 NS I P S S V P T + F A S Sbjct: 48 NSFIYIPPRGRSQQSDKKVQCYCPATGKYLGYFPALS 84 >gnl|CDD|144423 pfam00821, PEPCK, Phosphoenolpyruvate carboxykinase. Catalyses the formation of phosphoenolpyruvate by decarboxylation of oxaloacetate. Length = 586 Score = 24.1 bits (53), Expect = 8.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Query: 24 RPTTIPLVTQ 33 RP T+PLV + Sbjct: 401 RPDTVPLVYE 410 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.125 0.335 Gapped Lambda K H 0.267 0.0690 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 800,741 Number of extensions: 28393 Number of successful extensions: 43 Number of sequences better than 10.0: 1 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 7 Length of query: 79 Length of database: 6,263,737 Length adjustment: 49 Effective length of query: 30 Effective length of database: 5,204,896 Effective search space: 156146880 Effective search space used: 156146880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 51 (23.5 bits)