RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.393_1 (150 letters) >gnl|CDD|58616 cd04250, AAK_NAGK-C, AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis. In this pathway, glutamate is first N-acetylated and then phosphorylated by NAGK to give phosphoryl NAG, which is converted to NAG-ornithine. There are two variants of this pathway. In one, typified by the pathway in Thermotoga maritima and Pseudomonas aeruginosa, the acetyl group is recycled by reversible transacetylation from acetylornithine to glutamate. The phosphorylation of NAG by NAGK is feedback inhibited by arginine. In photosynthetic organisms, NAGK is the target of the nitrogen-signaling protein PII. Hexameric formation of NAGK domains appears to be essential to both arginine inhibition and NAGK-PII complex formation. NAGK-C are members of the Amino Acid Kinase Superfamily (AAK).. Length = 279 Score = 176 bits (447), Expect = 3e-45 Identities = 66/130 (50%), Positives = 99/130 (76%) Query: 12 ILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIG 71 +L + LP++Q + +T+V+KYGG+ M +L + F DI LLK I PV+VHGGGP+I Sbjct: 1 VLIEALPYIQKFRGKTVVIKYGGNAMKDEELKESFARDIVLLKYVGINPVVVHGGGPEIN 60 Query: 72 AVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNM 131 +L+K+GI+S+F NGLR+TD++T E+VEMVL G +NK+IVSLIN+ G +A+G+ GKDGN+ Sbjct: 61 EMLKKLGIESEFVNGLRVTDEETMEIVEMVLVGKVNKEIVSLINRAGGKAVGLSGKDGNL 120 Query: 132 VFAEKARHSL 141 + A+K ++ Sbjct: 121 IKAKKKDATV 130 >gnl|CDD|58604 cd04238, AAK_NAGK-like, AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like . Included in this CD are the Escherichia coli and Pseudomonas aeruginosa type NAGKs which catalyze the phosphorylation of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in bacteria and photosynthetic organisms using either the acetylated, noncyclic (NC), or non-acetylated, cyclic (C) route of ornithine biosynthesis. Also included in this CD is a distinct group of uncharacterized (UC) bacterial and archeal NAGKs. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 256 Score = 157 bits (399), Expect = 1e-39 Identities = 60/109 (55%), Positives = 87/109 (79%) Query: 28 IVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGL 87 +V+KYGG M +L + F +DI LLK+ I PVIVHGGGP+I +L+++GI+S+F NGL Sbjct: 1 VVIKYGGSAMKDEELKEAFADDIVLLKQVGINPVIVHGGGPEINELLKRLGIESEFVNGL 60 Query: 88 RITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEK 136 R+TD++T E+VEMVLAG +NK++VSL+N+ G +A+G+ GKDG ++ AEK Sbjct: 61 RVTDKETMEIVEMVLAGKVNKELVSLLNRAGGKAVGLSGKDGGLIKAEK 109 >gnl|CDD|30894 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism]. Length = 265 Score = 150 bits (381), Expect = 1e-37 Identities = 60/112 (53%), Positives = 83/112 (74%) Query: 25 NETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFE 84 +TIV+K GG M +L + F +DIALLK I PV+VHGGGPQI +L K+GI+ +F Sbjct: 2 GKTIVIKLGGSAMEDENLLEAFASDIALLKSVGIRPVVVHGGGPQIDEMLAKLGIEPEFV 61 Query: 85 NGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEK 136 GLR+TD +T EVVEMVL G++NK+IV+ +++ G QA+G+ G DGN+V A+K Sbjct: 62 KGLRVTDAETLEVVEMVLGGTVNKEIVARLSKHGGQAVGLSGVDGNLVTAKK 113 >gnl|CDD|133644 CHL00202, argB, acetylglutamate kinase; Provisional. Length = 284 Score = 138 bits (349), Expect = 7e-34 Identities = 55/124 (44%), Positives = 81/124 (65%) Query: 11 EILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQI 70 ++L + LP++Q + +V+KYGG M L D + DI L + V+VHGGGP+I Sbjct: 9 QVLSEALPYIQKFRGRIMVIKYGGAAMKNLILKADIIKDILFLSCIGLKIVVVHGGGPEI 68 Query: 71 GAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGN 130 L+++ I KF NG+R+TD+ T E+VEMVLAG +NK +V IN G +A+G+CGKD N Sbjct: 69 NFWLKQLNISPKFWNGIRVTDKVTMEIVEMVLAGKVNKDLVGSINANGGKAVGLCGKDAN 128 Query: 131 MVFA 134 ++ A Sbjct: 129 LIVA 132 >gnl|CDD|37647 KOG2436, KOG2436, KOG2436, Acetylglutamate kinase/acetylglutamate synthase [Amino acid transport and metabolism]. Length = 520 Score = 93.5 bits (232), Expect = 2e-20 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 1/123 (0%) Query: 11 EILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQI 70 IL + LP++ + ++ VV G ++ T L +D+A L + P++V G PQI Sbjct: 80 RILRESLPYITSFRDQKFVVIKSGEAIS-TSLLHSLASDLAFLHHVGLRPIVVPGTQPQI 138 Query: 71 GAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGN 130 +L + GI+ ++ +G R+TD T + + ++ N +V ++Q GT+A Sbjct: 139 NRLLAERGIEPEYVDGYRVTDAHTLQAAKESVSLEANLNLVINLSQLGTRARPSSSGVRV 198 Query: 131 MVF 133 F Sbjct: 199 GNF 201 >gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family. This family includes kinases that phosphorylate a variety of amino acid substrates, as well as uridylate kinase and carbamate kinase. This family includes: Aspartokinase EC:2.7.2.4. Acetylglutamate kinase EC:2.7.2.8. Glutamate 5-kinase EC:2.7.2.11. Uridylate kinase EC:2.7.4.-. Carbamate kinase EC:2.7.2.2. Length = 230 Score = 79.8 bits (197), Expect = 3e-16 Identities = 36/118 (30%), Positives = 54/118 (45%), Gaps = 3/118 (2%) Query: 26 ETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFEN 85 + IV+K GG + D K +IALL + I V+V GGG +L GI K Sbjct: 1 KRIVIKLGGSSLTDEDAIKRIAEEIALLSELGIKVVVVSGGGGFTDKLLAAYGIAEK--I 58 Query: 86 GLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLRL 143 GLR+T T ++E LAG + +VS + G +A+ + DG + + Sbjct: 59 GLRVTAGATGLIIEAALAG-LLDIVVSAGERLGARAVALLLSDGGIGAVRLDANDTEA 115 >gnl|CDD|58615 cd04249, AAK_NAGK-NC, AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis. There are two variants of this pathway. In one, typified by the pathway in Escherichia coli, glutamate is acetylated by acetyl-CoA and acetylornithine is deacylated hydrolytically. In this pathway, feedback inhibition by arginine occurs at the initial acetylation of glutamate and not at the phosphorylation of NAG by NAGK. Homodimeric NAGK-NC are members of the Amino Acid Kinase Superfamily (AAK).. Length = 252 Score = 71.5 bits (175), Expect = 9e-14 Identities = 31/115 (26%), Positives = 61/115 (53%), Gaps = 1/115 (0%) Query: 28 IVVKYGGHVMNCTDLSKDFVNDIA-LLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENG 86 +V+K GG ++ + + ++ ++ N VIVHGGG + +L+K+ S+ +NG Sbjct: 1 LVIKLGGALLETEAALEQLFSALSEYQQQHNRQLVIVHGGGCVVDELLKKLNFPSEKKNG 60 Query: 87 LRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSL 141 LR+T ++ + LAG+ NK++++ + G + +G+ DG M + L Sbjct: 61 LRVTPKEQIPYITGALAGTANKQLMAQAIKAGLKPVGLSLADGGMTAVTQLDPEL 115 >gnl|CDD|58618 cd04252, AAK_NAGK-fArgBP, AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP). The nuclear-encoded, mitochondrial polyprotein precursor with an N-terminal NAGK (ArgB) domain (this CD), a central DUF619 domain, and a C-terminal reductase domain (ArgC, N-Acetylglutamate Phosphate Reductase, NAGPR). The precursor is cleaved in the mitochondria into two distinct enzymes (NAGK-DUF619 and NAGPR). Native molecular weights of these proteins indicate that the kinase is an octamer whereas the reductase is a dimer. This CD also includes some gamma-proteobacteria (Xanthomonas and Xylella) NAG kinases with an N-terminal NAGK (ArgB) domain (this CD) and a C-terminal DUF619 domain. The DUF619 domain is described as a putative distant homolog of the acetyltransferase, ArgA, predicted to function in NAG synthase association in fungi. Eukaryotic sequences have an N-terminal mitochondrial transit peptide. Members of this NAG kinase domain CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 248 Score = 69.5 bits (170), Expect = 3e-13 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 3/96 (3%) Query: 29 VVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLR 88 V+K GG ++ D + ++ L+ + P++VHG GPQ+ LE G++ ++ +GLR Sbjct: 2 VIKVGGAII--EDDLDELAASLSFLQHVGLYPIVVHGAGPQLNEELEAAGVEPEYVDGLR 59 Query: 89 ITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGI 124 +TD +T V V N K+V + + G +A I Sbjct: 60 VTDPETLAVARKVFL-EENLKLVEALERNGARARPI 94 >gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK superfamily includes kinases that phosphorylate a variety of amino acid substrates. These kinases catalyze the formation of phosphoric anhydrides, generally with a carboxylate, and use ATP as the source of the phosphoryl group; are involved in amino acid biosynthesis. Some of these kinases control the process via allosteric feed-back inhibition.. Length = 248 Score = 69.7 bits (170), Expect = 3e-13 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 1/103 (0%) Query: 29 VVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLR 88 V+K+GG ++ + ++ + L V+VHG GPQI L G + GLR Sbjct: 1 VIKFGGSSVSSEERLRNLARILVKLASEGGRVVVVHGAGPQITDELLAHGELLGYARGLR 60 Query: 89 ITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNM 131 ITD++T + M S N I + + Q G +A+ + Sbjct: 61 ITDRETDALAAMGEGMS-NLLIAAALEQHGIKAVPLDLTQAGF 102 >gnl|CDD|58603 cd04237, AAK_NAGS-ABP, AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts. Domain architecture of these NAGS consisted of an N-terminal NAG kinase-like (ArgB) domain (this CD) and a C-terminal NAG synthase, acetyltransferase (ArgA) domain. Both bacterial and plant sequences in this CD have a conserved N-terminal extension; a similar sequence in the NAG kinases of the cyclic arginine-biosynthesis pathway has been implicated in feedback inhibition sensing. Plant sequences also have an N-terminal chloroplast transit peptide and an insert (approx. 70 residues) in the C-terminal region of ArgB. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 280 Score = 67.5 bits (165), Expect = 2e-12 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 2/102 (1%) Query: 15 QVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVL 74 + P++ + +T V+ +GG + + V+DIALL I V+VHG PQI L Sbjct: 8 EAAPYINAHRGKTFVIAFGGEAVAHPNFDN-IVHDIALLHSLGIRLVLVHGARPQIDQRL 66 Query: 75 EKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQ 116 + G++ ++ GLRITD E V AG++ +I +L++ Sbjct: 67 AERGLEPRYHRGLRITDAAALECV-KEAAGAVRLEIEALLSM 107 >gnl|CDD|58617 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC). This domain is similar to Escherichia coli and Pseudomonas aeruginosa NAGKs which catalyze the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis. These uncharacterized domain sequences are found in some bacteria (Deinococci and Chloroflexi) and archea and belong to the Amino Acid Kinase Superfamily (AAK).. Length = 257 Score = 66.8 bits (163), Expect = 2e-12 Identities = 43/127 (33%), Positives = 74/127 (58%), Gaps = 13/127 (10%) Query: 28 IVVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKF---E 84 IVVK GG V++ D I + ++VHGGG + L+++G++ KF Sbjct: 1 IVVKIGGSVVS------DLDKVIDDIANFGERLIVVHGGGNYVNEYLKRLGVEPKFVTSP 54 Query: 85 NGL--RITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKDGNMVFAEKARHSLR 142 +G+ R TD++T EV MV+ G INKKIV+ ++ G +A+G+ G DG ++ A++ + +R Sbjct: 55 SGIRSRYTDKETLEVFVMVM-GLINKKIVARLHSLGVKAVGLTGLDGRLLEAKR-KEIVR 112 Query: 143 LSPNTKK 149 ++ +K Sbjct: 113 VNERGRK 119 >gnl|CDD|58607 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms. Together, the fomA and fomB genes in the fosfomycin biosynthetic gene cluster of Streptomyces wedmorensis confer high-level fosfomycin resistance. FomA and FomB proteins converted fosfomycin to fosfomycin monophosphate and fosfomycin diphosphate in the presence of ATP and a magnesium ion, indicating that FomA and FomB catalyzed phosphorylations of fosfomycin and fosfomycin monophosphate, respectively. FomA and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 252 Score = 28.7 bits (64), Expect = 0.75 Identities = 23/108 (21%), Positives = 40/108 (37%), Gaps = 19/108 (17%) Query: 27 TIVVKYGGHVMNCTDLSKDFVNDI------ALLKKSNITPVIVHGGG----PQIGAVLEK 76 I++K GG V+ D + + L + + V+VHGGG P+ Sbjct: 1 MIILKLGGSVITDKDRPETIREENLERIARELAEAIDEKLVLVHGGGSFGHPKAKEYGLP 60 Query: 77 MGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGI 124 G S G+ T + E+ N +V + + G A+ + Sbjct: 61 DGDGSFSAEGVAETHEAMLEL---------NSIVVDALLEAGVPAVSV 99 >gnl|CDD|58601 cd04235, AAK_CK, AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP. Both CK (this CD) and nonhomologous CP synthetase synthesize carbamoyl phosphate, an essential precursor of arginine and pyrimidine bases, in the presence of ATP, bicarbonate, and ammonia. CK is a homodimer of 33 kDa subunits and is a member of the Amino Acid Kinase Superfamily (AAK).. Length = 308 Score = 28.5 bits (64), Expect = 0.77 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 50 IALLKKSNITPVIVHGGGPQIGAVLEKM 77 +A L K+ VI HG GPQ+G +L + Sbjct: 34 LADLIKNGHEVVITHGNGPQVGNLLLQN 61 >gnl|CDD|30895 COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism]. Length = 312 Score = 28.3 bits (63), Expect = 0.85 Identities = 13/36 (36%), Positives = 17/36 (47%) Query: 50 IALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFEN 85 IA L S VI HG GPQ+G +L + + Sbjct: 35 IADLIASGYEVVITHGNGPQVGLLLLQNEAADSEKG 70 >gnl|CDD|48440 cd01911, proteasome_alpha, proteasome alpha subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 different alpha and 10 different beta proteasome subunit genes while archaea have one of each.. Length = 209 Score = 28.1 bits (63), Expect = 1.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 114 INQTGTQAIGICGKDGNMVFAEKARHSLRLSPNT 147 + T A+GI GKDG ++ EK S L P++ Sbjct: 24 VKNGST-AVGIKGKDGVVLAVEKKVTSKLLDPSS 56 >gnl|CDD|48449 cd03751, proteasome_alpha_type_3, proteasome_alpha_type_3. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.. Length = 212 Score = 27.5 bits (61), Expect = 1.4 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 114 INQTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKK 149 + +GT AIGI KDG ++ EK S P + K Sbjct: 27 VENSGT-AIGIRCKDGVVLAVEKLVTSKLYEPGSNK 61 >gnl|CDD|145673 pfam02637, GatB_Yqey, GatB domain. This domain is found in GatB. It is about 140 amino acid residues long. This domain is found at the C terminus of GatB, which transamidates Glu-tRNA to Gln-tRNA. Length = 148 Score = 26.8 bits (60), Expect = 2.4 Identities = 7/25 (28%), Positives = 16/25 (64%) Query: 87 LRITDQQTAEVVEMVLAGSINKKIV 111 +T + AE+++++ G+I+ KI Sbjct: 38 SPLTPEHLAELIKLIDEGTISGKIA 62 >gnl|CDD|133132 cd06601, GH31_lyase_GLase, GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end. GLases cleave the bond between C1 and O1 of the nonreducing sugar residue of alpha-glucans to generate a monosaccharide product with a double bond between C1 and C2. This family corresponds to subgroup 2 in the Ernst et al classification of GH31 enzymes. Length = 332 Score = 26.3 bits (58), Expect = 3.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 45 DFVNDIALLKKSNITPVIVHGGG 67 D +++ L +NITPVI +GGG Sbjct: 71 DNLHNKGLKCSTNITPVISYGGG 93 >gnl|CDD|48452 cd03754, proteasome_alpha_type_6, proteasome_alpha_type_6. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.. Length = 215 Score = 26.3 bits (58), Expect = 3.4 Identities = 8/34 (23%), Positives = 16/34 (47%) Query: 114 INQTGTQAIGICGKDGNMVFAEKARHSLRLSPNT 147 + G ++ + GKD +V +K + P+T Sbjct: 25 VKNAGLTSVAVRGKDCAVVVTQKKVPDKLIDPST 58 >gnl|CDD|109795 pfam00752, XPG_N, XPG N-terminal domain. Length = 100 Score = 25.4 bits (56), Expect = 6.7 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Query: 31 KYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGP 68 + G + N T F + + LK I P+ V GGP Sbjct: 46 QLGNALQN-TSHLMGFFSRLCRLKDFGIKPIFVFDGGP 82 >gnl|CDD|29131 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like. This family contains a variety of different members of clade A of the serpin superfamily. They include the classical serine proteinase inhibitors, alpha-1-antitrypsin and alpha-1-antichymotrypsin, protein C inhibitor, kallistatin, and noninhibitory serpins, like corticosteroid and thyroxin binding globulins. In general, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants have been associated with blood clotting disorders, emphysema, cirrhosis, and dementia.. Length = 361 Score = 25.1 bits (55), Expect = 8.3 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 9/61 (14%) Query: 69 QIGAVLEKMGIKSKFENG---LRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGIC 125 + +L KMGI F + IT+Q +V + V K V +++ GT+A Sbjct: 270 NLKDILPKMGITDVFSDKADLSGITEQPNLKVSKAV------HKAVLDVDEKGTEAAAAT 323 Query: 126 G 126 G Sbjct: 324 G 324 >gnl|CDD|35405 KOG0184, KOG0184, KOG0184, 20S proteasome, regulatory subunit alpha type PSMA3/PRE10 [Posttranslational modification, protein turnover, chaperones]. Length = 254 Score = 24.9 bits (54), Expect = 8.4 Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 116 QTGTQAIGICGKDGNMVFAEKARHSLRLSPNTKK 149 + IGI KDG ++ EK S P + + Sbjct: 32 ENSGTCIGIKCKDGVVLAVEKLITSKLYEPGSNE 65 >gnl|CDD|36679 KOG1466, KOG1466, KOG1466, Translation initiation factor 2B, alpha subunit (eIF-2Balpha/GCN3) [Translation, ribosomal structure and biogenesis]. Length = 313 Score = 24.9 bits (54), Expect = 8.8 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 13/75 (17%) Query: 65 GGGPQIGAVLEKMGIKSKFENGLRITDQQTA---EVVEMVLAGSINKKIVS---LINQTG 118 G G + L+K+GI + D E V++VL G+ + +V +IN+ G Sbjct: 168 GSGKLMAKELKKLGIPVTL-----VLDSAVGYVMERVDLVLVGA--EGVVESGGIINKIG 220 Query: 119 TQAIGICGKDGNMVF 133 T + +C K N F Sbjct: 221 TYQVAVCAKSMNKPF 235 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.375 Gapped Lambda K H 0.267 0.0801 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,667,861 Number of extensions: 80586 Number of successful extensions: 262 Number of sequences better than 10.0: 1 Number of HSP's gapped: 259 Number of HSP's successfully gapped: 29 Length of query: 150 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 65 Effective length of database: 4,426,972 Effective search space: 287753180 Effective search space used: 287753180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.1 bits)