>TIGR00656 asp_kin_monofn asparate kinase, monofunctional class; InterPro: IPR005260 Aspartate kinase catalyzes the first step in the biosynthesis of Lys (via its precursor diaminopimelate), Met, and Thr. In E. coli, a distinct isozyme is inhibited by each of these three amino acid end products . The Met-sensitive (I) and Thr-sensitive (II) forms are bifunctional enzymes fused to homoserine dehydrogenase, which catalyses the next step in the biosynthesis of these amino acids. Inn contrast, the Lys-sensitive form (III) is a monofunctional enzyme; homoserine dehydrogenase is not part of the Lys biosynthetic pathway. This entry represents a subclass of aspartate kinases that are mostly Lys-sensitive and are not fused to homoserine dehydrogenase. The E. coli enzyme is a homodimer, while the Bacillus and Corynebacterium enzymes are alpha 2/beta 2 heterotetramers, where the beta subunit is translated from an in-phase alternative initiator at Met-246 , . The protein slr0657 from Synechocystis PCC6803 is extended by a duplication of the C-terminal region corresponding to the beta chain. Incorporation of a second copy of the C-terminal domain may be quite common in this subgroup of aspartokinases. ; GO: 0004072 aspartate kinase activity, 0009058 biosynthetic process.

Probab=98.12 E-value=6.7e-06 Score=53.25 Aligned_cols=86 Identities=30% Similarity=0.422 Sum_probs=70.2 Q ss_pred CEEEECH-----HHHHHHHHCCCEEEECCC-CCCCCCCEECC---CHHHHHHHHHHHHCHHHHHHHCCCCCEEECCC--- Q ss_conf 0135569-----999999977984998574-31787320066---14799999998625113343226763353455--- Q 537021.9.peg.3 6 NVIKVNR-----TILDLLIKSGIIPVIAPI-APGYDGATYNI---NADTFAGAIAEKLNVIRLLFLTDVPGVLDKNR--- 73 (142) Q Consensus 6 ~v~~vd~-----~~i~~lL~~g~iPVi~pi-g~~~~G~~~ni---n~D~~a~~lA~~l~A~kli~ltdv~Gv~d~~~--- 73 (142) T Consensus 161 ~~~~~~~~~~~~~~l~~~l~~g~~~~~~Gf~G~~~~g~~ttlGrGGsd~~a~~l~~~l~a~~~~~~tdv~G~~~~dPr~~ 240 (480) T TIGR00656 161 KIDELATEGLAAERLLPLLEEGIIPVVAGFQGATEEGDTTTLGRGGSDLTAALLGAALKADRVDIYTDVPGVYTTDPRVV 240 (480) T ss_pred EEEHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEECCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCC T ss_conf 00022246778888888875497589723335776764443047862378999875217763799744785012686424 Q ss_pred ---CCCCCCCHHHHHHHHHCC Q ss_conf ---555633888999996269 Q 537021.9.peg.3 74 ---QLISKLSINEARTLIKDG 91 (142) Q Consensus 74 ---~~i~~i~~~e~~~l~~~~ 91 (142) T Consensus 241 ~~a~~~~~~~~~e~~~la~~G 261 (480) T TIGR00656 241 EGAKKLPKISYEEALELATLG 261 (480) T ss_pred CCCCCCCCCCHHHHHHHHHCC T ss_conf 564322332389999997525

HHsearch alignment for GI: peg_394 and conserved domain: TIGR00656