HHsearch alignment for GI: peg_409 and conserved domain: COG4581

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair].
Probab=95.38  E-value=0.027  Score=35.93  Aligned_cols=62  Identities=18%  Similarity=0.138  Sum_probs=49.4

Q ss_pred             HHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99827688879984888996799999999998247898895667768789999999999996775
Q 537021.9.peg.4   25 LLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAW   89 (242)
Q Consensus        25 ~~a~~~~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~~RI~~~l~~~   89 (242)
T Consensus       128 ~~~Ler~esVlV~ApTssGKTvVaeyAi~~al~~~---qrviYTsPIKALsNQKyrdl~~~fgdv  189 (1041)
T COG4581         128 IAILERGESVLVCAPTSSGKTVVAEYAIALALRDG---QRVIYTSPIKALSNQKYRDLLAKFGDV  189 (1041)
T ss_pred             HHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHCC---CCEEECCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99984799579973378985559999999998718---944861630664206799999986005