HHsearch alignment for GI: peg_409 and conserved domain: KOG0354

>KOG0354 consensus.
Probab=91.68  E-value=0.095  Score=32.04  Aligned_cols=65  Identities=14%  Similarity=0.119  Sum_probs=43.4

Q ss_pred             CHHHHHHHCC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4899998276-88879984888996799999999998247898895667768789999999999996
Q 537021.9.peg.4   21 KSEQLLASDP-TRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEII   86 (242)
Q Consensus        21 ~~qq~~a~~~-~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~~RI~~~l   86 (242)
T Consensus        65 ~YQ~eivq~ALgkNtii~lPTG~GKTfIAa~Vm~nh~r-w~p~~KiVF~aP~~pLv~QQ~a~~~~~~  130 (746)
T KOG0354          65 NYQEELVQPALGKNTIIALPTGSGKTFIAAVIMKNHFE-WRPKGKVVFLAPTRPLVNQQIACFSIYL  130 (746)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHH-CCCCCEEEEEECCCHHHHHHHHHHHHCC
T ss_conf             78999867862687699953599861047999999972-3776438996077117888898876206