HHsearch alignment for GI: peg_409 and conserved domain: PRK08116

>PRK08116 hypothetical protein; Validated.
Probab=96.01  E-value=0.0051  Score=40.96  Aligned_cols=47  Identities=13%  Similarity=0.202  Sum_probs=33.1

Q ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8887998488899679999999999824789889566776878999999999999
Q 537021.9.peg.4   31 TRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEI   85 (242)
Q Consensus        31 ~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~~RI~~~   85 (242)
T Consensus       108 ~~GLll~G~~GtGKThLa~aIa~~l~~~g~---~V~~~~~~~-----ll~~lk~~  154 (262)
T PRK08116        108 SVGLLLWGSPGNGKTYLAAAIANELIEKGV---PVVFVNVPE-----LLNRIKST  154 (262)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHCCC---EEEEEEHHH-----HHHHHHHH
T ss_conf             861899898999899999999999998799---399988999-----99999999