HHsearch alignment for GI: peg_409 and conserved domain: PRK11747

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional.
Probab=94.46  E-value=0.037  Score=34.97  Aligned_cols=46  Identities=20%  Similarity=0.181  Sum_probs=31.8

Q ss_pred             CCCEEEEECCCCCHHHH-HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             88879984888996799-99999999824789889566776878999999
Q 537021.9.peg.4   31 TRSAWVSANAGSGKTHI-LVQRVLRLLLANAHPSTLLCLTHTKAAAAEMS   79 (242)
Q Consensus        31 ~~~~lV~A~aGSGKT~t-L~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~   79 (242)
T Consensus        47 ~~~l~iEAgTGtGKTlaYL~Pai~~a~~~~---~~vvIST~T~~LQeQL~   93 (697)
T PRK11747         47 RHILVIEAGTGVGKSLAYLLAGIPIARAEK---KKLVISTATVALQEQLV   93 (697)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHHHHCC---CCEEEECCCHHHHHHHH
T ss_conf             866999899972089999999999999829---97999889889999998