HHsearch alignment for GI: peg_409 and conserved domain: PRK13851

>PRK13851 type IV secretion system protein VirB11; Provisional.
Probab=95.41  E-value=0.0093  Score=39.14  Aligned_cols=43  Identities=16%  Similarity=0.216  Sum_probs=28.3

Q ss_pred             HHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             98276888799848889967999999999982478988956677687
Q 537021.9.peg.4   26 LASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTK   72 (242)
Q Consensus        26 ~a~~~~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~   72 (242)
T Consensus       157 ~aV~~r~NIlIsGgTGSGKTTllnA-Ll~~IP~~---eRIvtIEDt~  199 (343)
T PRK13851        157 ACVVGRLTMLLCGPTGSGKTTMSKT-LISAIPPQ---ERLITIEDTL  199 (343)
T ss_pred             HHHHCCCCEEEECCCCCCHHHHHHH-HHHCCCCC---CCEEEECCCC
T ss_conf             9997698899988898619999999-99628965---5279961150