>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

Probab=95.91 E-value=0.013 Score=38.07 Aligned_cols=51 Identities=16% Similarity=0.155 Sum_probs=30.0 Q ss_pred CCCCCEEEEECCCCCHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 76888799848889967999999999982-47898895667768789999999 Q 537021.9.peg.4 29 DPTRSAWVSANAGSGKTHILVQRVLRLLL-ANAHPSTLLCLTHTKAAAAEMSH 80 (242) Q Consensus 29 ~~~~~~lV~A~aGSGKT~tL~~rv~~ll~-~g~~P~~IL~lTFT~kAA~El~~ 80 (242) T Consensus 17 ~~~~~ill~GppGtGKT~la-~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 68 (151) T cd00009 17 PPPKNLLLYGPPGTGKTTLA-RAIANELFRPGAPFLYLNASDLLEGLVVAELF 68 (151) T ss_pred CCCCEEEEECCCCCCHHHHH-HHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHH T ss_conf 79980899899998865999-99999712137982785477704677775760

HHsearch alignment for GI: peg_409 and conserved domain: cd00009