HHsearch alignment for GI: peg_409 and conserved domain: cd00268

>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region.
Probab=96.30  E-value=0.0062  Score=40.39  Aligned_cols=70  Identities=20%  Similarity=0.195  Sum_probs=47.0

Q ss_pred             HHHCCCHHHHHHHC--CCCCEEEEECCCCCHHHHHHHHHHHHHH-CC-CCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             23509489999827--6888799848889967999999999982-47-89889566776878999999999999
Q 537021.9.peg.4   16 LISQTKSEQLLASD--PTRSAWVSANAGSGKTHILVQRVLRLLL-AN-AHPSTLLCLTHTKAAAAEMSHRVLEI   85 (242)
Q Consensus        16 ~~~~~~~qq~~a~~--~~~~~lV~A~aGSGKT~tL~~rv~~ll~-~g-~~P~~IL~lTFT~kAA~El~~RI~~~   85 (242)
T Consensus        19 ~~~pt~IQ~~~ip~il~g~dvi~~a~TGSGKTlay~lpil~~l~~~~~~~~~~alil~PTrELa~Qi~~~~~~l   92 (203)
T cd00268          19 FEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEKLDPSPKKDGPQALILAPTRELALQIAEVARKL   92 (203)
T ss_pred             CCCCCHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHHHHHHHHHHHHH
T ss_conf             99999999999999977998899757997222888869999986166768966999968799999999999985