HHsearch alignment for GI: peg_409 and conserved domain: pfam05970

>pfam05970 DUF889 PIF1 helicase. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated.
Probab=95.93  E-value=0.0029  Score=42.71  Aligned_cols=38  Identities=21%  Similarity=0.239  Sum_probs=30.1

Q ss_pred             ECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             48889967999999999982478988956677687899999
Q 537021.9.peg.4   38 ANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEM   78 (242)
Q Consensus        38 A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El   78 (242)
T Consensus         1 G~AGTGKS~ll~~i~~~l~~~~---~~v~vtA~TGiAA~~i   38 (418)
T pfam05970         1 GYGGTGKTFLWNALSARIRSRG---KIVLNVASSGIAALLL   38 (418)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCC---CEEEEECCHHHHHHCC
T ss_conf             9798879999999999997689---8899989689998516