RPSBLAST alignment for GI: peg_409 and conserved domain: TIGR00609

>gnl|CDD|161956 TIGR00609, recB, exodeoxyribonuclease V, beta subunit. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 1087
 Score = 53.6 bits (129), Expect = 5e-08
 Identities = 34/113 (30%), Positives = 52/113 (46%), Gaps = 3/113 (2%)

Query: 38  ANAGSGKTHILVQRVLRLLL--ANAHPSTLLCLTHTKAAAAEMSHRVLE-IITAWSHLSD 94
           A+AG+GKT  + Q  LRLLL         +L +T T AA  E+  R+   I  A   L  
Sbjct: 16  ASAGTGKTFTIAQLYLRLLLEGGPLTVEEILVVTFTNAATEELKTRIRGRIHQALRALKA 75

Query: 95  EILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQF 147
            + S E+ +   +      + +A   L   L T     + TIH FC+ +++Q 
Sbjct: 76  ALTSQELPEPLKEAIQDEKVKQAITRLRNALATMDEAAIYTIHGFCQRMLEQH 128