RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.42_1 (44 letters) >gnl|CDD|144147 pfam00444, Ribosomal_L36, Ribosomal protein L36. Length = 38 Score = 30.2 bits (69), Expect = 0.13 Identities = 19/40 (47%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Query: 5 KVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG 44 KVR+S+ K R + K+VRRK + ++ K NPR K RQG Sbjct: 2 KVRSSV---KKRCKDCKIVRRKGRVYVICKTNPRHKQRQG 38 >gnl|CDD|30606 COG0257, RpmJ, Ribosomal protein L36 [Translation, ribosomal structure and biogenesis]. Length = 38 Score = 27.1 bits (60), Expect = 1.3 Identities = 15/32 (46%), Positives = 21/32 (65%) Query: 13 LKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG 44 +K R R K+VRRK + ++ K NP+ K RQG Sbjct: 7 VKKRCRDCKIVRRKGRVYVICKKNPKHKQRQG 38 >gnl|CDD|176954 CHL00011, ndhD, NADH dehydrogenase subunit 4. Length = 498 Score = 24.9 bits (55), Expect = 4.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Query: 15 LRHRGNKVVRR 25 L HRGNKV+R Sbjct: 24 LPHRGNKVIRW 34 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.331 0.145 0.399 Gapped Lambda K H 0.267 0.0611 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 478,335 Number of extensions: 14600 Number of successful extensions: 68 Number of sequences better than 10.0: 1 Number of HSP's gapped: 68 Number of HSP's successfully gapped: 8 Length of query: 44 Length of database: 6,263,737 Length adjustment: 17 Effective length of query: 27 Effective length of database: 5,896,384 Effective search space: 159202368 Effective search space used: 159202368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (23.7 bits)