HHsearch alignment for GI: peg_473 and conserved domain: PRK06872

>PRK06872 DNA polymerase III subunits gamma and tau; Provisional.
Probab=96.09  E-value=0.085  Score=31.35  Aligned_cols=94  Identities=18%  Similarity=0.220  Sum_probs=70.1

Q ss_pred             HHHHHHCCHHHHHHHHHHCCCCEEECCCEEEEEECCC----CCHHHHHHHHHHHHHHCCCCEEEEEECCCC---------
Q ss_conf             9999861826679999726400450498089997789----997799999999998609925999968974---------
Q 537021.9.peg.4   68 IELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKE----IPEDFIENLATKLKNWTGEDWEIRFSLGRC---------  134 (165)
Q Consensus        68 veL~~~~rei~Lk~~Le~~VrLVsFe~GrIei~~~~~----a~~~l~~~Ls~~L~~wTG~rW~VslS~g~~---------  134 (165)
T Consensus       576 ~~li~qL~L~GlvrQLA~NSvl~~~~gd~l~L~L~~~q~hL~nd~~~erL~~ALse~lG~~V~L~IevGd~~~~eTPae~  655 (696)
T PRK06872        576 TKIVERLGLTGLSKQLALNSVLLSKTGDEIKLGLRSAKSHLDNDRSIKSLAQALSKLQGKDIRLTISLGDDANLKTPLEY  655 (696)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHHEECCCEEEEEECHHHHHHCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHH
T ss_conf             99998769827999999843111122998899877898876699999999999999878995899998998777799999


Q ss_pred             ------------HHHHHCCHHHHHHHHHCCCCEE--EEEEEC
Q ss_conf             ------------1366539699999986799778--987745
Q 537021.9.peg.4  135 ------------CEYFEIDSDIKAVRTIFPTAQV--VCIRTI  162 (165)
Q Consensus       135 ------------~e~~~~dp~V~avl~~FPgAeI--~~VR~~  162 (165)
T Consensus       656 r~ri~qEr~~qA~~sL~~DP~VQ~L~q~F-gAqLde~SIrPl  696 (696)
T PRK06872        656 RRQIYQALREKAKKALQKDEKLQLLLQEF-DAELDLSSIRPV  696 (696)
T ss_pred             HHHHHHHHHHHHHHHHHCCHHHHHHHHHC-CCEECCCCEEEC
T ss_conf             99999999999999997398999999970-988857871009