RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.473_1 (165 letters) >gnl|CDD|181656 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated. Length = 598 Score = 69.5 bits (171), Expect = 4e-13 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 15/113 (13%) Query: 66 QLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDW 125 ++ L E+ D K+ ++R + +V FE GRLE + P D + LA KL+ WTG W Sbjct: 464 DIVALAEEKRDIKLKAAVERDVRLVRFEPGRLEFALAPGAPRDLAQRLARKLEEWTGRRW 523 Query: 126 EIRFSLGRCCEYF---------------EIDSDIKAVRTIFPTAQVVCIRTIP 163 + S E D + AV FP A++V +R + Sbjct: 524 VVSVSREGGQPTLAEQEAAAREEREAAAEADPLVAAVLAAFPGAKIVDVRDLA 576 >gnl|CDD|152797 pfam12362, DUF3646, DNA polymerase III gamma and tau subunits C terminal. This domain family is found in bacteria, and is approximately 120 amino acids in length. The family is found in association with pfam00004. The proteins in this family are frequently annotated as the gamma and tau subunits of DNA polymerase III, however there is little accompanying literature to back this up. Length = 117 Score = 69.5 bits (171), Expect = 4e-13 Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 15/110 (13%) Query: 66 QLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDW 125 L+ L D K+ ++R + +VSFE GR+E P D + L KL+ WTG W Sbjct: 8 DLVALARAKRDIKLKVEVERDVRLVSFEPGRIEFRPTPGAPRDLAQRLGRKLQEWTGRRW 67 Query: 126 EIRFSLGRCCEYF---------------EIDSDIKAVRTIFPTAQVVCIR 160 + S ++AV FP A++V +R Sbjct: 68 AVSLSNEGGAPTLAEQEAAAKEALRADARAHPLVQAVLAAFPGAKIVDVR 117 >gnl|CDD|168927 PRK07374, dnaE, DNA polymerase III subunit alpha; Validated. Length = 1170 Score = 28.5 bits (64), Expect = 0.95 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Query: 86 FLHVVSFE--LGRLEVSFLKEIPEDFIENLATKLK 118 +L V+ + L RL+++ L EI E++ E L+ +LK Sbjct: 304 YLTEVTEQGLLKRLKLNSLDEIDENYKERLSYELK 338 >gnl|CDD|131978 TIGR02932, vnfK_nitrog, V-containing nitrogenase, beta subunit. Nitrogenase is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, VnfK, represents the beta subunit of the vanadium (V)-containing alternative nitrogenase. It is homologous to NifK and AnfK, of the molybdenum-containing and the iron (Fe)-only types, respectively. Length = 457 Score = 27.5 bits (61), Expect = 1.6 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Query: 113 LATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPT 153 L ++K D + S GR Y ID++I VR FPT Sbjct: 375 LEKRIKAKLDIDLIMGHSKGR---YVAIDANIPMVRVGFPT 412 >gnl|CDD|180921 PRK07306, PRK07306, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 720 Score = 26.6 bits (59), Expect = 3.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 97 LEVSFLKEIPEDFIENLATKLKN 119 +E +F+K+ +FIE L LK Sbjct: 66 IESAFIKKYRPEFIEKLYQFLKA 88 >gnl|CDD|183785 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed. Length = 574 Score = 26.2 bits (58), Expect = 4.2 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 6/53 (11%) Query: 106 PEDFIENLATKLKNWTGEDWE---IRFSLG---RCCEYFEIDSDIKAVRTIFP 152 D E T LK+ TG ++ + L E+FE ++++K V T++P Sbjct: 68 VADSREAARTYLKHETGAFFDAAAVEAFLDNGPEMVEFFERETEVKFVPTLYP 120 >gnl|CDD|182375 PRK10318, PRK10318, hypothetical protein; Provisional. Length = 121 Score = 25.9 bits (57), Expect = 4.7 Identities = 5/24 (20%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 107 EDFIENLATKLKNWTGEDWEIRFS 130 E FI+ +A+ + +G+ + ++ Sbjct: 74 EQFIDKVASS-SSISGKPYIVKCP 96 >gnl|CDD|184312 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional. Length = 637 Score = 25.7 bits (57), Expect = 5.4 Identities = 9/23 (39%), Positives = 18/23 (78%) Query: 102 LKEIPEDFIENLATKLKNWTGED 124 LKEI ++ ++N++ +K +TG+D Sbjct: 468 LKEIAKEAVQNVSAIIKKFTGKD 490 >gnl|CDD|162191 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily. Length = 726 Score = 25.5 bits (56), Expect = 7.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Query: 101 FLKEIPEDFIENLATKLK 118 FL EIP + +E +T + Sbjct: 628 FLNEIPAELLETASTGRR 645 >gnl|CDD|177962 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog. Length = 808 Score = 25.3 bits (55), Expect = 7.5 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Query: 65 KQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENL 113 KQ IEL E + D K E L F++ + L + E I ++ Sbjct: 754 KQAIELGELDDDGKRNEYLYE-----KFQVVLVGRKGLSQEGESLISSI 797 >gnl|CDD|134000 PHA02142, PHA02142, putative RNA ligase. Length = 366 Score = 25.3 bits (55), Expect = 8.0 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Query: 98 EVSFLKEIPE-DFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDS 142 +++ L+ IP D IE + W + F +G C YFEIDS Sbjct: 14 KIADLQPIPGADAIE--VATIDGWEVVVKKGEFRVGDDCVYFEIDS 57 >gnl|CDD|178402 PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome]. Length = 555 Score = 25.4 bits (55), Expect = 8.3 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 103 KEIPEDFIENLATKLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQ 155 K +P++ I+ L L++ D++ R+ G+ F +I V +FP ++ Sbjct: 92 KLVPQELIDELKAILQDNMTLDYDERYFHGKPQNSFHKAVNIPDV-VVFPRSE 143 >gnl|CDD|179018 PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional. Length = 461 Score = 25.1 bits (56), Expect = 8.3 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 139 EIDSDIKAVRTIFPTAQVVCI 159 EI + +KA R +P ++V + Sbjct: 336 EIKATLKAARQGYPDKRIVAV 356 >gnl|CDD|177932 PLN02295, PLN02295, glycerol kinase. Length = 512 Score = 25.0 bits (55), Expect = 9.3 Identities = 15/74 (20%), Positives = 28/74 (37%), Gaps = 12/74 (16%) Query: 1 LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLN-RLSACT 59 L + W K L+AL + + LP+ +S+ E I + + ++ C Sbjct: 199 LKTLDW--DKPTLEALGIPA-----EILPKIVSNSEVI----GTIAKGWPLAGVPIAGCL 247 Query: 60 PDNYTKQLIELCEK 73 D + L + C Sbjct: 248 GDQHAAMLGQRCRP 261 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0689 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,676,965 Number of extensions: 157800 Number of successful extensions: 356 Number of sequences better than 10.0: 1 Number of HSP's gapped: 356 Number of HSP's successfully gapped: 26 Length of query: 165 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 79 Effective length of database: 4,136,185 Effective search space: 326758615 Effective search space used: 326758615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.3 bits)