BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.473_1 (165 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.473_1 Length = 165 Score = 342 bits (877), Expect = 2e-96, Method: Compositional matrix adjust. Identities = 165/165 (100%), Positives = 165/165 (100%) Query: 1 LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTP 60 LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTP Sbjct: 1 LHAISWKKRKKKLDALNVSSFAIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTP 60 Query: 61 DNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNW 120 DNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNW Sbjct: 61 DNYTKQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNW 120 Query: 121 TGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL 165 TGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL Sbjct: 121 TGEDWEIRFSLGRCCEYFEIDSDIKAVRTIFPTAQVVCIRTIPNL 165 >gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Score = 23.9 bits (50), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 10/76 (13%) Query: 54 RLSACTPDNYTKQLIELCEKNHDYK--MVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIE 111 +++ TP+ Y +++LC++ + M + R + V +EL EV F DF + Sbjct: 414 QVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIV--YELPLNEVIF------DFYD 465 Query: 112 NLATKLKNWTGEDWEI 127 L + K + D+ + Sbjct: 466 RLKSVSKGYASFDYNV 481 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 23.5 bits (49), Expect = 2.2, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 116 KLKNWTGEDWEIRFSLGRCCEYFEIDSDIKAVRTI 150 K KN+ ++ + GR Y EI+S ++R I Sbjct: 848 KTKNFVRQNGYVETIFGRRIHYDEINSPKSSIRNI 882 >gi|254780725|ref|YP_003065138.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 427 Score = 22.7 bits (47), Expect = 3.8, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 16/23 (69%) Query: 92 FELGRLEVSFLKEIPEDFIENLA 114 + +GR++ +F+ +P + ENL+ Sbjct: 223 YPVGRIDKAFVSRLPVFYAENLS 245 >gi|254780876|ref|YP_003065289.1| hypothetical protein CLIBASIA_03865 [Candidatus Liberibacter asiaticus str. psy62] Length = 210 Score = 22.3 bits (46), Expect = 4.5, Method: Compositional matrix adjust. Identities = 10/35 (28%), Positives = 17/35 (48%) Query: 14 DALNVSSFAIGENALPRNISSDECFPLAEAGITEK 48 DA++ + + EN L + +A+A I EK Sbjct: 60 DAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK 94 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.414 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,970 Number of Sequences: 1233 Number of extensions: 3745 Number of successful extensions: 11 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 7 length of query: 165 length of database: 328,796 effective HSP length: 68 effective length of query: 97 effective length of database: 244,952 effective search space: 23760344 effective search space used: 23760344 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)