RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.476_1 (241 letters) >gnl|CDD|162493 TIGR01695, mviN, integral membrane protein MviN. This model represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions. Although frequently listed as a virulence protein, it is not restricted to pathogens and it is an essential protein in Sinorhizobium meliloti. In a number of species its gene is adjacent to that of the uridylyltransferase GlnD, the signal-transducing enzyme that performs the key modification to the nitrogen regulatory protein PII. Length = 502 Score = 91.6 bits (228), Expect = 2e-19 Identities = 61/237 (25%), Positives = 114/237 (48%), Gaps = 11/237 (4%) Query: 4 KLVRNFFTLVASESVNRCLGFVRASLMAAVFGVGKITDAFYTVAYVEFIFVRLAARGDGV 63 L+++ + +R GFVR +++A+ FG G DAF + F RL A +G Sbjct: 1 SLLKSTLIVSLGTLFSRITGFVRDAIIASAFGAGLTADAFNVAFVIPNFFRRLFA--EGA 58 Query: 64 IHNSFIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFP 123 +++F+P+F++ +++ + A R + + LL + ++++++I + V ++APGF Sbjct: 59 FNSAFVPVFTKAKKKE--KEARRAFANTVTTLLILSLLLVVLIGIFFAPFVISLLAPGF- 115 Query: 124 YQSDEYFLTVQLSRVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIFVLTYA 183 + L V L+R++ P + ISLA++ GIL A R+FI ++ +I I L + Sbjct: 116 -ADETRSLAVSLTRIMFPYLLLISLAAVFGGILNARKRFFIPSFSPILFNIGVILSLLFF 174 Query: 184 LCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPRLTCNVKLFL 240 A L GV + I +K+G L+ ++ +K FL Sbjct: 175 DWNYGQYSLA-----LAIGVLIGGVAQLLIQLPFLRKAGFLLKPRFNFRDPGLKRFL 226 >gnl|CDD|150794 pfam10166, DUF2368, Uncharacterized conserved protein (DUF2368). This family is conserved from nematodes to humans. The function is not known. Length = 131 Score = 31.6 bits (72), Expect = 0.17 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Query: 155 ILFASGRYFIACMPSMVIHILP-IFVLTYA--LCYGSNMHK----AEMI 196 +L +G P +VI I+P FV+ Y + YG + + AE I Sbjct: 61 VLGLAGGALKKKKPLLVIPIVPLGFVVGYQYDMAYGDKLQRIREEAERI 109 >gnl|CDD|119144 pfam10624, TraS, Plasmid conjugative transfer entry exclusion protein TraS. Entry exclusion (Eex) is a process which prevents redundant transfer of DNA between donor cells. TraS is a protein involved in Eex. It blocks redundant conjugative DNA synthesis and transport between donor cells, and it is suggested that TraS interferes with a signalling pathway that is required to trigger DNA transfer. TraS on the recipient cell is known to form an interaction with TraG on the donor cell. Length = 164 Score = 29.1 bits (65), Expect = 1.1 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 173 HILPIFVLTYALCYGSNMHKAEMIYLLCWGVFLAHAVYFWILYLSAKKSGVELRFQYPR 231 HI + V+ + CY ++ AE ++LC+ + L ++ W+ KK+ + F++ + Sbjct: 6 HIALVTVIQFIACYLADWGSAETGFILCF-ILLWQGLFIWLFIQIRKKNHISDEFKFSK 63 Score = 26.8 bits (59), Expect = 5.5 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 7/58 (12%) Query: 68 FIPMFSQRREQNGSENAWRLSSEVFSVLLPILMVMIMVIELVLPLLVRYVMAPGFPYQ 125 FI +F Q R++N + ++ S ++ +++P V L+ PLL + G Y+ Sbjct: 42 FIWLFIQIRKKNHISDEFKFSKGIWYIIMP-------VCSLLSPLLSLMIFIGGTLYE 92 >gnl|CDD|172875 PRK14399, PRK14399, membrane protein; Provisional. Length = 258 Score = 28.3 bits (63), Expect = 1.6 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Query: 137 RVVMPSIFFISLASLVTGILFASGRYFIACMPSMVIHILPIF 178 +V+ +IF I L S++ LF+ YFI C+ +++ H PI+ Sbjct: 71 KVLFTAIFAILL-SMIPNELFSQTSYFIPCIFALIGHCWPIY 111 >gnl|CDD|151477 pfam11030, Nucleocapsid-N, Nucleocapsid protein N. This is the N protein of the nucleocapsid. The nucleocapsid functions to protect the RNA against nuclease degradation and to promote it's reverse transcription. The NC protein promotes viral RNA dimerization and encapsidation and initiates reverse transcription by activating the annealing of the primer tRNA to the initiation site. Length = 167 Score = 27.8 bits (61), Expect = 2.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 68 FIPMFSQRREQNGSENAWRLS 88 F PMF++RR NG++N R + Sbjct: 41 FRPMFNRRRNNNGNQNRGRQN 61 >gnl|CDD|162106 TIGR00917, 2A060601, Niemann-Pick C type protein family. The model describes Niemann-Pick C type protein in eukaryotes. The defective protein has been associated with Niemann-Pick disease which is described in humans as autosomal recessive lipidosis. It is characterized by the lysosomal accumulation of unestrified cholesterol. It is an integral membrane protein, which indicates that this protein is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis. Length = 1204 Score = 27.1 bits (60), Expect = 3.7 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 18/80 (22%) Query: 91 VFSVL-LPILMVMIMVIE-LVLPLLVRYVMAPGFPYQSDEYF-------------LTVQL 135 VFS + L ++++ VI LVL + V + YQ E F L QL Sbjct: 625 VFSYIGLKATLIIMEVIPFLVLAVGVDNIFILVQTYQRLERFYREVGVDNEQELTLEQQL 684 Query: 136 SRVVM---PSIFFISLASLV 152 R + PSI SL+ + Sbjct: 685 GRALGEVGPSITLASLSESL 704 >gnl|CDD|180884 PRK07207, PRK07207, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 965 Score = 26.9 bits (60), Expect = 4.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 127 DEYFLTVQLSRVVMPSIFFISLA 149 D YFL V +R+ +P FF+ +A Sbjct: 306 DRYFLHVDGTRIELPQAFFMRVA 328 >gnl|CDD|184448 PRK14010, PRK14010, potassium-transporting ATPase subunit B; Provisional. Length = 673 Score = 26.2 bits (57), Expect = 7.8 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 12/62 (19%) Query: 95 LLPILMV---MIMVIELVLPLLVRYVMAPG-FPYQSDEYFLTVQLSRVVMPSIFFISLAS 150 L P+ M+ ++ V+E+ + L + + P F +S +SR+ + SIF I L + Sbjct: 24 LYPVYMIKNPIMFVVEVGMLLALGLTIYPDLFHQES--------VSRLYVFSIFIILLLT 75 Query: 151 LV 152 LV Sbjct: 76 LV 77 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.334 0.144 0.439 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,886,217 Number of extensions: 248515 Number of successful extensions: 885 Number of sequences better than 10.0: 1 Number of HSP's gapped: 879 Number of HSP's successfully gapped: 51 Length of query: 241 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 150 Effective length of database: 4,028,145 Effective search space: 604221750 Effective search space used: 604221750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 56 (25.3 bits)