BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 537021.9.peg.493_1
         (64 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>537021.9.peg.493_1 
          Length = 64

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%)

Query: 1  LWDKIDYFASSNIFIMIGMIISMAICKAHRNCIRGIISWIIWIEEIKYYCKEANIVSMFG 60
          LWDKIDYFASSNIFIMIGMIISMAICKAHRNCIRGIISWIIWIEEIKYYCKEANIVSMFG
Sbjct: 1  LWDKIDYFASSNIFIMIGMIISMAICKAHRNCIRGIISWIIWIEEIKYYCKEANIVSMFG 60

Query: 61 LYSS 64
          LYSS
Sbjct: 61 LYSS 64


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.332    0.142    0.478 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,251
Number of Sequences: 1233
Number of extensions: 1198
Number of successful extensions: 3
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of query: 64
length of database: 328,796
effective HSP length: 35
effective length of query: 29
effective length of database: 285,641
effective search space:  8283589
effective search space used:  8283589
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 31 (16.5 bits)