RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.523_1 (38 letters) >gnl|CDD|178585 PLN03008, PLN03008, Phospholipase D delta. Length = 868 Score = 24.7 bits (53), Expect = 4.9 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 7/40 (17%) Query: 6 IKGVIDRALDMTGYVPSHLL-------RGKVFGYRQKVAA 38 + G D + M Y P+H RG+V+GYR + A Sbjct: 741 MAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVYGYRMSLWA 780 >gnl|CDD|152563 pfam12128, DUF3584, Protein of unknown function (DUF3584). This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. There are two conserved sequence motifs: GKT and YLP. Length = 1192 Score = 25.0 bits (55), Expect = 5.0 Identities = 4/15 (26%), Positives = 6/15 (40%) Query: 2 LDKLIKGVIDRALDM 16 +DKL V + Sbjct: 184 IDKLANAVHSKEGKF 198 >gnl|CDD|165912 PLN02270, PLN02270, phospholipase D alpha. Length = 808 Score = 24.9 bits (54), Expect = 5.1 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Query: 8 GVIDRALDMTGYVPSHL-----LRGKVFGYR 33 G D + M GY P HL RG++ G+R Sbjct: 684 GARDSEIAMGGYQPYHLSTRQPARGQIHGFR 714 >gnl|CDD|178741 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional. Length = 2102 Score = 24.3 bits (53), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 2 LDKLIKGVIDRALDMTGYVPSHL 24 LD + G+I+R LD+ P L Sbjct: 1436 LDMVKAGIIERVLDILPEAPDSL 1458 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.327 0.145 0.417 Gapped Lambda K H 0.267 0.0763 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 645,732 Number of extensions: 21241 Number of successful extensions: 74 Number of sequences better than 10.0: 1 Number of HSP's gapped: 74 Number of HSP's successfully gapped: 9 Length of query: 38 Length of database: 5,994,473 Length adjustment: 12 Effective length of query: 26 Effective length of database: 5,735,177 Effective search space: 149114602 Effective search space used: 149114602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)