RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.523_1 (38 letters) >2ip1_A Tryptophanyl-tRNA synthetase; rossmann fold, structural genomics, PSI-2, protein structure initiative; HET: PG4; 1.80A {Saccharomyces cerevisiae} Length = 432 Score = 24.4 bits (52), Expect = 7.2 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 10/41 (24%) Query: 3 DKLIK---------GVIDRALDMTGYVPSHLL-RGKVFGYR 33 DKLIK + R +TG P H L +G F R Sbjct: 48 DKLIKQFGTKPVNEETLKRFKQVTGREPHHFLRKGLFFSER 88 >3hzr_A Tryptophanyl-tRNA synthetase; APO tRNA-ligase, structural genomics, medical structural genomics of pathogenic protozoa, MSGPP; 3.00A {Entamoeba histolytica} Length = 386 Score = 23.9 bits (51), Expect = 8.8 Identities = 10/41 (24%), Positives = 15/41 (36%), Gaps = 10/41 (24%) Query: 3 DKLIK---------GVIDRALDMTGYVPSHLL-RGKVFGYR 33 ++LI I R ++G P H L RG + Sbjct: 28 NQLINSVGINAITPQQIQRIEKLSGKAPHHYLSRGVFLAEK 68 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.327 0.145 0.417 Gapped Lambda K H 0.267 0.0457 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 341,684 Number of extensions: 8559 Number of successful extensions: 32 Number of sequences better than 10.0: 1 Number of HSP's gapped: 32 Number of HSP's successfully gapped: 8 Length of query: 38 Length of database: 5,693,230 Length adjustment: 12 Effective length of query: 26 Effective length of database: 5,402,302 Effective search space: 140459852 Effective search space used: 140459852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.7 bits)