Query 537021.9.peg.542_1 Match_columns 54 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 19:56:40 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_542.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PHA01886 TM2 domain-containing 59.9 2.9 7.4E-05 22.2 0.3 12 13-24 46-57 (80) 2 COG5518 Bacteriophage capsid p 54.5 8.4 0.00021 19.8 2.0 29 17-45 46-74 (492) 3 pfam03656 Pam16 Pam16. The Pam 35.2 23 0.00058 17.5 1.7 18 31-48 69-86 (127) 4 TIGR02916 PEP_his_kin putative 31.6 43 0.0011 16.1 2.6 30 2-31 183-222 (696) 5 TIGR03061 pip_yhgE_Nterm YhgE/ 27.0 44 0.0011 16.0 2.0 25 12-36 16-40 (164) 6 pfam11251 DUF3050 Protein of u 21.2 47 0.0012 15.9 1.2 30 17-48 155-184 (232) 7 KOG0614 consensus 21.0 48 0.0012 15.8 1.2 16 35-50 527-542 (732) 8 KOG4506 consensus 16.2 34 0.00086 16.6 -0.4 15 40-54 572-586 (598) 9 TIGR03171 soxL2 Rieske iron-su 13.9 92 0.0024 14.3 1.3 18 29-46 33-50 (321) 10 PRK12301 bssS biofilm formatio 13.5 27 0.0007 17.1 -1.5 20 28-47 18-37 (84) No 1 >PHA01886 TM2 domain-containing protein Probab=59.92 E-value=2.9 Score=22.17 Aligned_cols=12 Identities=42% Similarity=0.778 Sum_probs=10.1 Q ss_pred CHHHHHHHHHHH Q ss_conf 056783889999 Q 537021.9.peg.5 13 IDIFLIPAMFSS 24 (54) Q Consensus 13 idiflipamfss 24 (54) ||+||||.|-.. T Consensus 46 iDLfLIP~Mv~~ 57 (80) T PHA01886 46 IDLFLTAGLVQS 57 (80) T ss_pred HHHHHCCCHHHH T ss_conf 999964417778 No 2 >COG5518 Bacteriophage capsid portal protein [General function prediction only] Probab=54.53 E-value=8.4 Score=19.75 Aligned_cols=29 Identities=38% Similarity=0.607 Sum_probs=21.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 83889999999998503569998399998 Q 537021.9.peg.5 17 LIPAMFSSLLLISLFDSYECVMMGFDYLF 45 (54) Q Consensus 17 lipamfsslllislfdsyecvmmgfdylf 45 (54) +++-.--|-.|-.+.|.|+|..|||-|-+ T Consensus 46 l~~I~e~stilqqclDay~~n~~Gfg~d~ 74 (492) T COG5518 46 LKEILERSTILQQCLDAYECNIMGFGYDP 74 (492) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCCC T ss_conf 79887664799999888976311433378 No 3 >pfam03656 Pam16 Pam16. The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM). In Saccharomyces cerevisiae, Pam16 is required for preprotein translocation into the matrix, but not for protein insertion into the inner membrane. Pam16 has a degenerate J domain. J-domain proteins play important regulatory roles as co-chaperones, recruiting Hsp70 partners and accelerating the ATP-hydrolysis step of the chaperone cycle. Pam16's J-like domain strongly interacts with Pam18's J domain, leading to a productive interaction of Pam18 with mtHsp70 at the mitochondria import channel. Pam18 stimulates the ATPase activity of mtHsp70. Probab=35.20 E-value=23 Score=17.51 Aligned_cols=18 Identities=28% Similarity=0.191 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 503569998399998478 Q 537021.9.peg.5 31 FDSYECVMMGFDYLFSRN 48 (54) Q Consensus 31 fdsyecvmmgfdylfsrn 48 (54) -.+.|.++--|++||..| T Consensus 69 ~~~~EeI~k~y~~LF~~N 86 (127) T pfam03656 69 DLNMEEVNKRYEHLFEVN 86 (127) T ss_pred CCCHHHHHHHHHHHHHCC T ss_conf 999999999999998637 No 4 >TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases. They all contain a GAF domain that is present in phytochromes and cGMP-specific phosphodiesterases, and which has been experimentally proven to be involved in protein:protein interactions. They also contain a C-terminal histidine kinase domain, which is composed of a dimerisation sub-domain and an ATP/ADP-binding phosphotransfer, or catalytic, sub-domain. The proteins in this entry are found strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria, where members of IPR014264 from INTERPRO and IPR014266 from INTERPRO also occur.. Probab=31.62 E-value=43 Score=16.10 Aligned_cols=30 Identities=43% Similarity=0.729 Sum_probs=18.0 Q ss_pred HHHHHHHH----HHCCHHH------HHHHHHHHHHHHHHH Q ss_conf 02231042----4330567------838899999999985 Q 537021.9.peg.5 2 VFSFYLYA----VRGIDIF------LIPAMFSSLLLISLF 31 (54) Q Consensus 2 vfsfylya----vrgidif------lipamfsslllislf 31 (54) ||.||||| .+.+|.= +|.||--.|+++|.- T Consensus 183 V~dfyLyadA~Lf~~ld~~~W~aRG~~~Al~~PLia~Sa~ 222 (696) T TIGR02916 183 VFDFYLYADALLFRRLDTDVWAARGLVAALVVPLIAVSAA 222 (696) T ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999978874002524788988999999999999973 No 5 >TIGR03061 pip_yhgE_Nterm YhgE/Pip N-terminal domain. This family contains the N-terminal domain of a family of multiple membrane-spanning proteins of Gram-positive bacteria. One member was shown to be a host protein essential for phage infection, so many members of this family are called "phage infection protein". A separate model, TIGR03062, represents the conserved C-terminal domain. The domains are separated by regions highly variable in both length and sequence, often containing extended heptad repeats as described in model TIGR03057. Probab=26.96 E-value=44 Score=16.00 Aligned_cols=25 Identities=36% Similarity=0.709 Sum_probs=21.0 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 3056783889999999998503569 Q 537021.9.peg.5 12 GIDIFLIPAMFSSLLLISLFDSYEC 36 (54) Q Consensus 12 gidiflipamfsslllislfdsyec 36 (54) -+-+.+||..++.+.+-+..|.|.- T Consensus 16 ~~~~~liP~ly~~~~l~a~wdPy~~ 40 (164) T TIGR03061 16 LIAIMLIPLLYGGLFLWAFWDPYGN 40 (164) T ss_pred HHHHHHHHHHHHHHHHHHHCCCCCC T ss_conf 9999999999999998463687556 No 6 >pfam11251 DUF3050 Protein of unknown function (DUF3050). This bacterial family of proteins has no known function. Probab=21.18 E-value=47 Score=15.86 Aligned_cols=30 Identities=30% Similarity=0.450 Sum_probs=18.3 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 83889999999998503569998399998478 Q 537021.9.peg.5 17 LIPAMFSSLLLISLFDSYECVMMGFDYLFSRN 48 (54) Q Consensus 17 lipamfsslllislfdsyecvmmgfdylfsrn 48 (54) +||.||.+++--.-...-+| --|-|-+.|. T Consensus 155 lIPdMF~~Il~~l~~~~~~~--~~f~yYL~RH 184 (232) T pfam11251 155 LIPDMFRAILDELNIPETQL--PTFRYYLERH 184 (232) T ss_pred CHHHHHHHHHHHHCCCCCCH--HHHHHHHHHH T ss_conf 34999999999733786432--8999999998 No 7 >KOG0614 consensus Probab=20.96 E-value=48 Score=15.84 Aligned_cols=16 Identities=31% Similarity=0.960 Sum_probs=13.9 Q ss_pred HHHHHHHHHHHHHHHH Q ss_conf 6999839999847877 Q 537021.9.peg.5 35 ECVMMGFDYLFSRNLL 50 (54) Q Consensus 35 ecvmmgfdylfsrnll 50 (54) .||+-+|+||.++|.. T Consensus 527 acv~EAfeYLH~k~iI 542 (732) T KOG0614 527 ACVLEAFEYLHRKGII 542 (732) T ss_pred HHHHHHHHHHHHCCCE T ss_conf 7899999999864804 No 8 >KOG4506 consensus Probab=16.21 E-value=34 Score=16.62 Aligned_cols=15 Identities=53% Similarity=0.696 Sum_probs=11.8 Q ss_pred HHHHHHHHHHHHHHC Q ss_conf 399998478777629 Q 537021.9.peg.5 40 GFDYLFSRNLLSKIF 54 (54) Q Consensus 40 gfdylfsrnllskif 54 (54) .-|||.|||.++.|| T Consensus 572 agdylvsrNkk~q~~ 586 (598) T KOG4506 572 AGDYLVSRNKKPQIF 586 (598) T ss_pred CCCHHHCCCCCCHHH T ss_conf 020332035441367 No 9 >TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2. This iron-sulfur protein is found in a contiguous genomic region with subunits of cytochrome b558/566 in several archaeal species, and appears to be part of a cytochrome bc1-analogous system. Probab=13.88 E-value=92 Score=14.35 Aligned_cols=18 Identities=56% Similarity=0.763 Sum_probs=16.2 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 985035699983999984 Q 537021.9.peg.5 29 SLFDSYECVMMGFDYLFS 46 (54) Q Consensus 29 slfdsyecvmmgfdylfs 46 (54) +-||+-|-|--|-||||. T Consensus 33 t~fd~~efv~kg~dylfn 50 (321) T TIGR03171 33 TKFDSREFVNKGEDYLFN 50 (321) T ss_pred CCCCHHHHHHHHHHHHHH T ss_conf 453489887512577654 No 10 >PRK12301 bssS biofilm formation regulatory protein BssS; Reviewed Probab=13.45 E-value=27 Score=17.10 Aligned_cols=20 Identities=35% Similarity=0.632 Sum_probs=17.0 Q ss_pred HHHHHHHHHHHHHHHHHHHH Q ss_conf 99850356999839999847 Q 537021.9.peg.5 28 ISLFDSYECVMMGFDYLFSR 47 (54) Q Consensus 28 islfdsyecvmmgfdylfsr 47 (54) ||-.|+|...|..+.|+-|. T Consensus 18 iSTVD~YDAmMiRLHylss~ 37 (84) T PRK12301 18 ISTVDSYDALMLRLHYQTPN 37 (84) T ss_pred CCCCCCHHHHHHEEEECCCC T ss_conf 46654264465301115887 Done!