BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= 537021.9.peg.574_1 (51 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|302818017|ref|XP_002990683.1| hypothetical protein SELMODRAFT_429070 [Selaginella moellendorffii] gi|300141605|gb|EFJ08315.1| hypothetical protein SELMODRAFT_429070 [Selaginella moellendorffii] Length = 1291 Score = 34.7 bits (78), Expect = 4.1, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 1 MKYKEKYGKNRNISFIPIIIIVLSKKISMPFVHSMLRAG 39 ++Y EKYGKN N SF+ I+ + K+S F L G Sbjct: 680 VEYVEKYGKNENCSFLEAAEIIFTAKVSGTFSRRQLSQG 718 Searching..................................................done ***** No hits found ****** Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.334 0.148 0.465 Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,030,765,397 Number of Sequences: 13984884 Number of extensions: 28550903 Number of successful extensions: 107331 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 107329 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 4,792,584,752 effective HSP length: 24 effective length of query: 27 effective length of database: 4,456,947,536 effective search space: 120337583472 effective search space used: 120337583472 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 76 (33.7 bits)