RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.574_1 (51 letters) >gnl|CDD|73158 cd01699, RNA_dep_RNAP, RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage. RdRp catalyzes synthesis of the RNA strand complementary to a given RNA template. RdRps of many viruses are products of processing of polyproteins. Some RdRps consist of one polypeptide chain, and others are complexes of several subunits. The domain organization and the 3D structure of the catalytic center of a wide range of RdRps, including those with a low overall sequence homology, are conserved. The catalytic center is formed by several motifs containing a number of conserved amino acid residues. This subfamily represents the RNA-dependent RNA polymerases from all positive-strand RNA eukaryotic viruses with no DNA stage.. Length = 278 Score = 27.2 bits (60), Expect = 1.1 Identities = 9/43 (20%), Positives = 16/43 (37%) Query: 4 KEKYGKNRNISFIPIIIIVLSKKISMPFVHSMLRAGLRPPCIF 46 K + GK R I P+ + + PF +++ P Sbjct: 33 KVEAGKTRLIQPRPLDYNIALRMYLGPFEAKLMKNRGGLPIAV 75 >gnl|CDD|176548 cd08606, GDPD_YPL110cp_fungi, Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL110cp and other uncharacterized fungal homologs. The product of S. cerevisiae ORF YPL110c (GDE1), YPL110cp (Gde1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL110cp has been characterized as a cytoplasmic glycerophosphocholine (GPC)-specific phosphodiesterase that selectively hydrolyzes GPC, not glycerophosphoinositol (GPI), to generate choline and glycerolphosphate. YPL110cp has multi-domain architecture, including not only C-terminal GDPD, but also an SPX N-terminal domain along with several ankyrin repeats, which implies that YPL110cp may mediate protein-protein interactions in a variety of proteins and play a role in maintaining cellular phosphate levels. Members in this family are distantly related to S. cerevisiae YPL206cp, which selectively catalyzes the cleavage of phosphatidylglycerol (PG), not glycerophosphoinositol (GPI) or glycerophosphocholine (GPC), to diacylglycerol (DAG) and glycerophosphate, and has been characterized as a PG-specific phospholipase C. Length = 286 Score = 26.6 bits (59), Expect = 1.4 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Query: 6 KYGKNRNI---SFIPIIIIVLSKK 26 YG RNI SF P I I+LS K Sbjct: 161 DYGAGRNIIFSSFTPDICILLSLK 184 >gnl|CDD|173895 cd00517, ATPS, ATP-sulfurylase. ATP-sulfurylase (ATPS), also known as sulfate adenylate transferase, catalyzes the transfer of an adenylyl group from ATP to sulfate, forming adenosine 5'-phosphosulfate (APS). This reaction is generally accompanied by a further reaction, catalyzed by APS kinase, in which APS is phosphorylated to yield 3'-phospho-APS (PAPS). In some organisms the APS kinase is a separate protein, while in others it is incorporated with ATP sulfurylase in a bifunctional enzyme that catalyzes both reactions. In bifunctional proteins, the domain that performs the kinase activity can be attached at the N-terminal end of the sulfurylase unit or at the C-terminal end, depending on the organism. While the reaction is ubiquitous among organisms, the physiological role of the reaction varies. In some organisms it is used to generate APS from sulfate and ATP, while in others it proceeds in the opposite direction to generate ATP from APS and pyrophosphate. ATP sulfurylase can be a monomer, a homodimer, or a homo-oligomer, depending on the organism. ATPS belongs to a large superfamily of nucleotidyltransferases that includes pantothenate synthetase (PanC), phosphopantetheine adenylyltransferase (PPAT), and the amino-acyl tRNA synthetases. The enzymes of this family are structurally similar and share a dinucleotide-binding domain. Length = 353 Score = 24.1 bits (53), Expect = 7.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 26 KISMPFVHSMLRAGLRPP 43 IS + MLR G +PP Sbjct: 321 NISGTKLRKMLREGEKPP 338 >gnl|CDD|145087 pfam01747, ATP-sulfurylase, ATP-sulfurylase. This family consists of ATP-sulfurylase or sulfate adenylyltransferase EC:2.7.7.4 some of which are part of a bifunctional polypeptide chain associated with adenosyl phosphosulphate (APS) kinase pfam01583. Both enzymes are required for PAPS (phosphoadenosine-phosphosulfate) synthesis from inorganic sulphate. ATP sulfurylase catalyses the synthesis of adenosine-phosphosulfate APS from ATP and inorganic sulphate. Length = 310 Score = 24.1 bits (53), Expect = 8.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Query: 26 KISMPFVHSMLRAGLRPPCIF 46 IS + MLR G PP F Sbjct: 277 FISGTKLREMLREGEEPPEWF 297 >gnl|CDD|32229 COG2046, MET3, ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism]. Length = 397 Score = 24.1 bits (52), Expect = 9.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 26 KISMPFVHSMLRAGLRPPCIF 46 IS + MLRAG++PP F Sbjct: 344 HISGTKLREMLRAGVKPPEEF 364 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.334 0.148 0.465 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 669,496 Number of extensions: 24254 Number of successful extensions: 149 Number of sequences better than 10.0: 1 Number of HSP's gapped: 149 Number of HSP's successfully gapped: 11 Length of query: 51 Length of database: 6,263,737 Length adjustment: 24 Effective length of query: 27 Effective length of database: 5,745,121 Effective search space: 155118267 Effective search space used: 155118267 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 51 (23.4 bits)