BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.574_1 (51 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.574_1 Length = 51 Score = 102 bits (255), Expect = 9e-25, Method: Compositional matrix adjust. Identities = 51/51 (100%), Positives = 51/51 (100%) Query: 1 MKYKEKYGKNRNISFIPIIIIVLSKKISMPFVHSMLRAGLRPPCIFCIHRI 51 MKYKEKYGKNRNISFIPIIIIVLSKKISMPFVHSMLRAGLRPPCIFCIHRI Sbjct: 1 MKYKEKYGKNRNISFIPIIIIVLSKKISMPFVHSMLRAGLRPPCIFCIHRI 51 >gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62] Length = 779 Score = 21.2 bits (43), Expect = 3.2, Method: Composition-based stats. Identities = 6/12 (50%), Positives = 11/12 (91%) Query: 22 VLSKKISMPFVH 33 +LS+K+ +PF+H Sbjct: 164 ILSQKLKIPFLH 175 >gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 8/15 (53%), Positives = 11/15 (73%) Query: 5 EKYGKNRNISFIPII 19 EKYGKN N++ +I Sbjct: 93 EKYGKNYNLTVALLI 107 >gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] Length = 116 Score = 20.0 bits (40), Expect = 7.1, Method: Compositional matrix adjust. Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 15 FIPIIIIVLSKKISMPFVHSMLRA 38 +I +++IVLS + PF+ + Sbjct: 10 WISVLLIVLSNVYAQPFLEETEKG 33 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.148 0.465 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,068 Number of Sequences: 1233 Number of extensions: 932 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 51 length of database: 328,796 effective HSP length: 24 effective length of query: 27 effective length of database: 299,204 effective search space: 8078508 effective search space used: 8078508 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 31 (16.5 bits)