RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.612_1 (53 letters) >1syy_A Ribonucleoside-diphosphate reductase beta chain; DIIRON, oxygen activation, iron coupled radical, immune evasion, replication; 1.70A {Chlamydia trachomatis} SCOP: a.25.1.2 PDB: 2ani_A Length = 346 Score = 27.4 bits (60), Expect = 0.82 Identities = 12/17 (70%), Positives = 13/17 (76%) Query: 37 MDLKKENNFFETRTTEY 53 +DL KE NFFETR EY Sbjct: 322 IDLNKEKNFFETRVIEY 338 >1h0o_A Ribonucleoside-diphosphate reductase; oxidoreductase, ribonucleotide reductase, dinuclear metal-cluster; 2.2A {Mus musculus} SCOP: a.25.1.2 PDB: 1h0n_A 1w68_A 1w69_A 1xsm_A 2uw2_A 3hf1_A 2vux_A Length = 390 Score = 27.0 bits (59), Expect = 0.95 Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 37 MDLKKENNFFETRTTEY 53 + L+ + NFFE R EY Sbjct: 354 ISLEGKTNFFEKRVGEY 370 >3n37_A Ribonucleoside-diphosphate reductase 2 subunit BE; ribonucleotide reductase, four-helix bundle, dimanganese CLU oxidoreductase; 1.65A {Escherichia coli} PDB: 3n38_A 3n39_B* 3n3a_B* 3n3b_B* 1r2f_A 2bq1_I* 2r2f_A Length = 319 Score = 27.1 bits (59), Expect = 1.1 Identities = 5/34 (14%), Positives = 14/34 (41%) Query: 20 FHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY 53 F + ++ +I + + ++FF + Y Sbjct: 271 FPAEMAEVNPAILAALSPNADENHDFFSGSGSSY 304 >1jk0_A RNR Y2, ribonucleoside-diphosphate reductase small chain 1; ribonucleotide reductase, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: a.25.1.2 PDB: 1smq_A Length = 419 Score = 26.2 bits (57), Expect = 1.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 37 MDLKKENNFFETRTTEY 53 + L + NFFE R ++Y Sbjct: 380 ISLAGKTNFFEKRVSDY 396 >1r2f_A Protein (ribonucleotide reductase R2); nucleotide metabolism, oxidoreductase; 2.10A {Salmonella typhimurium} SCOP: a.25.1.2 PDB: 2bq1_I* 2r2f_A Length = 319 Score = 25.1 bits (54), Expect = 4.4 Identities = 4/23 (17%), Positives = 9/23 (39%) Query: 31 IFHKSKMDLKKENNFFETRTTEY 53 I + + ++FF + Y Sbjct: 282 ILAALSPNADENHDFFSGSGSSY 304 >2p1i_A Ribonucleotide reductase, small chain; F222 twinning, plasmodb PY03671, structural genomics consortium, SGC, oxidoreductase; 2.70A {Plasmodium yoelii yoelii str} Length = 349 Score = 24.8 bits (53), Expect = 4.8 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 37 MDLKKENNFFETRTTEY 53 + L+ + NFFE R +Y Sbjct: 313 ISLQGKTNFFEKRVADY 329 >3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Length = 329 Score = 24.5 bits (53), Expect = 5.8 Identities = 7/35 (20%), Positives = 15/35 (42%) Query: 19 YFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY 53 F +T +S +I + + ++FF + Y Sbjct: 280 LFPTDETKVSPAILSSLSPNADENHDFFSGSGSSY 314 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 435,350 Number of extensions: 12647 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 13 Length of query: 53 Length of database: 5,693,230 Length adjustment: 25 Effective length of query: 28 Effective length of database: 5,087,130 Effective search space: 142439640 Effective search space used: 142439640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.6 bits)