RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.634_1 (45 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.3 bits (55), Expect = 3.9 Identities = 10/36 (27%), Positives = 16/36 (44%), Gaps = 8/36 (22%) Query: 4 RIVSSIFSGQ--SLVYEKILFEIEFLGDHHRYACFI 37 ++V+ IF GQ + Y FE E + Y + Sbjct: 155 QLVA-IFGGQGNTDDY----FE-ELRDLYQTYHVLV 184 Score = 24.5 bits (53), Expect = 6.1 Identities = 8/38 (21%), Positives = 16/38 (42%), Gaps = 8/38 (21%) Query: 5 IVSSIFSGQSLVYEKIL------FEIEFLG--DHHRYA 34 + S + + ++++L FE +L D H A Sbjct: 68 VSSLVEPSKVGQFDQVLNLCLTEFENCYLEGNDIHALA 105 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.335 0.150 0.463 Gapped Lambda K H 0.267 0.0582 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 411,464 Number of extensions: 11790 Number of successful extensions: 45 Number of sequences better than 10.0: 1 Number of HSP's gapped: 45 Number of HSP's successfully gapped: 2 Length of query: 45 Length of database: 5,693,230 Length adjustment: 18 Effective length of query: 27 Effective length of database: 5,256,838 Effective search space: 141934626 Effective search space used: 141934626 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.4 bits)