Query         537021.9.peg.683_1
Match_columns 37
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Tue May 24 23:26:02 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_683.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2oqb_A Histone-arginine methyl  24.8      26  0.0011   17.2   1.6   24   13-36     56-82  (117)
  2 3fyf_A Protein BVU-3222; struc   9.4 1.2E+02   0.005   14.1   1.8   21   13-33    130-161 (176)
  3 2hlg_A Fruit-specific protein;   9.2      44  0.0018   16.2  -0.5   12   19-30      2-13  (39)
  4 3fs3_A Nucleosome assembly pro   7.3 1.6E+02  0.0069   13.4   1.8   25    8-32    155-179 (359)
  5 2e50_A Protein SET; histone ch   7.2 1.4E+02  0.0059   13.7   1.4   25    8-32    119-143 (225)
  6 2kr1_A Ubiquitin protein ligas   6.1 1.2E+02  0.0049   14.1   0.4   13   19-31     45-57  (82)
  7 1vjh_A BET V I allergen family   5.8   2E+02  0.0084   13.0   2.2   18    3-20     58-75  (122)
  8 1x49_A Interferon-induced, dou   5.6 1.2E+02  0.0048   14.2   0.2   16   18-33     19-34  (97)
  9 2grx_C Protein TONB; beta barr   5.3 1.8E+02  0.0075   13.3   1.0   27   10-36    163-189 (229)
 10 2r41_A Uncharacterized protein   5.0 2.3E+02  0.0095   12.8   1.9   31    1-35     32-68  (110)

No 1  
>2oqb_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase, transcriptional regulation, activation domain; 1.69A {Rattus norvegicus}
Probab=24.77  E-value=26  Score=17.18  Aligned_cols=24  Identities=25%  Similarity=0.474  Sum_probs=20.0

Q ss_pred             EEEEEEEC---HHHHCCCCEEEECCCC
Q ss_conf             99997500---5531678726531476
Q 537021.9.peg.6   13 LIFQFTIN---EYCRSNRNSITFSSGE   36 (37)
Q Consensus        13 lifqftin---eycrsnrnsitfssge   36 (37)
                      -+|++.||   |+||-.+.|+.++.|.
T Consensus        56 ~vfk~~V~~dTECcRVGk~Sy~iTlg~   82 (117)
T 2oqb_A           56 CVFKCSVSRETECSRVGRQSFIITLGC   82 (117)
T ss_dssp             EEEEEEEETTSEEEEETTTEEEEEETT
T ss_pred             EEEEEEECCCCCEEEECCEEEEEEECC
T ss_conf             999988427853146625279999668


No 2  
>3fyf_A Protein BVU-3222; structural genomics, periplasmic, PSI-2, protein structure initiative; 2.20A {Bacteroides vulgatus atcc 8482}
Probab=9.42  E-value=1.2e+02  Score=14.09  Aligned_cols=21  Identities=14%  Similarity=0.128  Sum_probs=12.9

Q ss_pred             EEEEEEECHHHHC-----------CCCEEEEC
Q ss_conf             9999750055316-----------78726531
Q 537021.9.peg.6   13 LIFQFTINEYCRS-----------NRNSITFS   33 (37)
Q Consensus        13 lifqftineycrs-----------nrnsitfs   33 (37)
                      .-++|.|.-|--.           ||++|+|+
T Consensus       130 ~s~~v~Itl~~~gN~asV~V~pnfnr~~It~s  161 (176)
T 3fyf_A          130 VSATVSIVLTGGTNQASVTINPNFSGNTLTMN  161 (176)
T ss_dssp             CEEEEEEEECTTSSEEEEEEEETTCCCCEEEE
T ss_pred             EEEEEEEEEECCCCEEEEEECCCCCCCCEEEE
T ss_conf             88999999937995479997647788816786


No 3  
>2hlg_A Fruit-specific protein; beta antiparallel, plant protein; NMR {Lycopersicon esculentum}
Probab=9.23  E-value=44  Score=16.15  Aligned_cols=12  Identities=50%  Similarity=0.739  Sum_probs=8.4

Q ss_pred             ECHHHHCCCCEE
Q ss_conf             005531678726
Q 537021.9.peg.6   19 INEYCRSNRNSI   30 (37)
Q Consensus        19 ineycrsnrnsi   30 (37)
                      -|+||.+|..-|
T Consensus         2 CN~yCt~NsDC~   13 (39)
T 2hlg_A            2 CNEPCSSNSDCI   13 (39)
T ss_dssp             CSCBCSSSGGGS
T ss_pred             CCCCCCCCCCEE
T ss_conf             654236777855


No 4  
>3fs3_A Nucleosome assembly protein 1, putative; protein localization, histone recognition, structural analysis, chaperone; 2.30A {Plasmodium falciparum 3D7} PDB: 3hfd_A 3gyw_A 3gyv_A
Probab=7.25  E-value=1.6e+02  Score=13.43  Aligned_cols=25  Identities=24%  Similarity=0.429  Sum_probs=17.4

Q ss_pred             CCCEEEEEEEEECHHHHCCCCEEEE
Q ss_conf             2403799997500553167872653
Q 537021.9.peg.6    8 AKSFSLIFQFTINEYCRSNRNSITF   32 (37)
Q Consensus         8 aksfslifqftineycrsnrnsitf   32 (37)
                      ..+|.|.|.|.-|+|-...--.-+|
T Consensus       155 ~~gf~l~F~F~~NpyF~N~vLtK~y  179 (359)
T 3fs3_A          155 KEGFILSFYFATNPFFSNSVLTKTY  179 (359)
T ss_dssp             --CEEEEEEECSCSSBCCSEEEEEE
T ss_pred             CCCEEEEEEECCCCCCCCCEEEEEE
T ss_conf             7754899984788776665379999


No 5  
>2e50_A Protein SET; histone chaperone, inhat, PP2AI, protein binding; HET: TRE; 2.30A {Homo sapiens} SCOP: d.305.1.1
Probab=7.24  E-value=1.4e+02  Score=13.75  Aligned_cols=25  Identities=24%  Similarity=0.374  Sum_probs=17.4

Q ss_pred             CCCEEEEEEEEECHHHHCCCCEEEE
Q ss_conf             2403799997500553167872653
Q 537021.9.peg.6    8 AKSFSLIFQFTINEYCRSNRNSITF   32 (37)
Q Consensus         8 aksfslifqftineycrsnrnsitf   32 (37)
                      ..+|.|.|.|.-|+|-...--.-+|
T Consensus       119 ~~~f~l~F~F~~NpyF~N~~L~K~y  143 (225)
T 2e50_A          119 KSGYRIDFYFDENPYFENKVLSKEF  143 (225)
T ss_dssp             CCCEEEEEEECSCSSBSCSEEEEEE
T ss_pred             CCCEEEEEECCCCCCCCCCEEEEEE
T ss_conf             8755999965888765677689999


No 6  
>2kr1_A Ubiquitin protein ligase E3A; UBL conjugation pathway, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens}
Probab=6.06  E-value=1.2e+02  Score=14.13  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=9.0

Q ss_pred             ECHHHHCCCCEEE
Q ss_conf             0055316787265
Q 537021.9.peg.6   19 INEYCRSNRNSIT   31 (37)
Q Consensus        19 ineycrsnrnsit   31 (37)
                      -|++|+|+++-.-
T Consensus        45 ~N~~C~Ss~~f~~   57 (82)
T 2kr1_A           45 TNEFCASCPTFLR   57 (82)
T ss_dssp             CCTTSTTSTTCCC
T ss_pred             CCCCCCCCCCCCC
T ss_conf             9997858888789


No 7  
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A
Probab=5.81  E-value=2e+02  Score=13.03  Aligned_cols=18  Identities=22%  Similarity=0.015  Sum_probs=15.1

Q ss_pred             HHHHCCCCEEEEEEEEEC
Q ss_conf             344202403799997500
Q 537021.9.peg.6    3 NILKKAKSFSLIFQFTIN   20 (37)
Q Consensus         3 nilkkaksfslifqftin   20 (37)
                      .+++.-|||..++||+-.
T Consensus        58 di~~~yksf~~~i~v~p~   75 (122)
T 1vjh_A           58 EIQKYFKTLKGSIAVTPI   75 (122)
T ss_dssp             TGGGTEEEEEEEEEEEEC
T ss_pred             EHHHCEEEEEEEEEEEEC
T ss_conf             624112468999999975


No 8  
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1
Probab=5.60  E-value=1.2e+02  Score=14.16  Aligned_cols=16  Identities=25%  Similarity=0.509  Sum_probs=9.8

Q ss_pred             EECHHHHCCCCEEEEC
Q ss_conf             5005531678726531
Q 537021.9.peg.6   18 TINEYCRSNRNSITFS   33 (37)
Q Consensus        18 tineycrsnrnsitfs   33 (37)
                      .++|||..++-.++|.
T Consensus        19 ~L~E~~Qk~~~~~~y~   34 (97)
T 1x49_A           19 KLNKYRQMHGVAITYK   34 (97)
T ss_dssp             HHHHHHHHHTCCEEEE
T ss_pred             HHHHHHHHCCCCCEEE
T ss_conf             9999998759997189


No 9  
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A
Probab=5.32  E-value=1.8e+02  Score=13.27  Aligned_cols=27  Identities=11%  Similarity=0.070  Sum_probs=20.9

Q ss_pred             CEEEEEEEEECHHHHCCCCEEEECCCC
Q ss_conf             037999975005531678726531476
Q 537021.9.peg.6   10 SFSLIFQFTINEYCRSNRNSITFSSGE   36 (37)
Q Consensus        10 sfslifqftineycrsnrnsitfssge   36 (37)
                      .-+.++.|+|++-.+-..-.|.-|||.
T Consensus       163 ~G~v~V~f~I~~~G~V~~v~i~~SSG~  189 (229)
T 2grx_C          163 EGQVKVKFDVTPDGRVDNVQILSAKPA  189 (229)
T ss_dssp             CEEECEEEECCTTSCCEEEEECCCSSS
T ss_pred             CCEEEEEEEECCCCCEEEEEEEECCCC
T ss_conf             877999999828998968899866896


No 10 
>2r41_A Uncharacterized protein; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.90A {Enterococcus faecalis V583}
Probab=5.03  E-value=2.3e+02  Score=12.78  Aligned_cols=31  Identities=23%  Similarity=0.404  Sum_probs=19.8

Q ss_pred             CCHHHHC------CCCEEEEEEEEECHHHHCCCCEEEECCC
Q ss_conf             9034420------2403799997500553167872653147
Q 537021.9.peg.6    1 MWNILKK------AKSFSLIFQFTINEYCRSNRNSITFSSG   35 (37)
Q Consensus         1 mwnilkk------aksfslifqftineycrsnrnsitfssg   35 (37)
                      ||.|+.+      ....-++|++.-|+    ++-+|.|+..
T Consensus        32 ~W~iID~~lk~~~~LdyL~iF~L~~~~----~~l~i~~~Qe   68 (110)
T 2r41_A           32 IWLIIDLNLKGVIPLNDLLHFDLLNNN----GKVTVHFSQE   68 (110)
T ss_dssp             HHHHHHHHTBTTBCCCSEEEEEEEEET----TEEEEEEEET
T ss_pred             HHHHHHHHHCCCCCCCCEEEEEEEECC----CEEEEEEEEC
T ss_conf             999998773267656316999988049----8899999613


Done!