Query         537021.9.peg.683_1
Match_columns 37
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Wed May 25 02:21:43 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_683.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1qu6a2 d.50.1.1 (A:91-179) ds   6.5      74  0.0054   13.9   0.8   15   19-33     20-34  (89)
  2 d1x48a1 d.50.1.1 (A:8-83) dsRN   6.0      74  0.0054   13.9   0.6   14   19-32      5-18  (76)
  3 d2e50a1 d.305.1.1 (A:1-222) Pr   5.9   1E+02  0.0076   13.2   1.4   24    9-32    120-143 (222)
  4 d1x49a1 d.50.1.1 (A:8-92) dsRN   5.4      69   0.005   14.1   0.2   14   19-32     13-26  (85)
  5 d2dixa1 d.50.1.1 (A:7-79) Inte   4.2   1E+02  0.0074   13.3   0.4   14   19-32      8-21  (73)
  6 d1vjha_ d.129.3.1 (A:) Hypothe   3.1   2E+02   0.014   11.9   2.2   18    3-20     58-75  (120)
  7 d1ekza_ d.50.1.1 (A:) Staufen,   2.6 1.8E+02   0.013   12.1   0.4   15   19-33     13-27  (76)
  8 d1biaa2 b.34.1.1 (A:271-317) B   2.5 1.7E+02   0.012   12.2   0.1   10   28-37     35-44  (47)
  9 d1vyva1 b.34.2.1 (A:71-215) SH   2.5 1.4E+02    0.01   12.6  -0.3   31    7-37     16-54  (145)
 10 d1kshb_ b.1.18.8 (B:) GMP-PDE    2.5 1.9E+02   0.014   12.0   0.3   14   23-36     55-68  (149)

No 1  
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]}
Probab=6.47  E-value=74  Score=13.94  Aligned_cols=15  Identities=20%  Similarity=0.501  Sum_probs=10.1

Q ss_pred             ECHHHHCCCCEEEEC
Q ss_conf             005531678726531
Q 537021.9.peg.6   19 INEYCRSNRNSITFS   33 (37)
Q Consensus        19 ineycrsnrnsitfs   33 (37)
                      +||||..++-.+.|.
T Consensus        20 L~E~~Qk~~~~~~y~   34 (89)
T d1qu6a2          20 INRIAQKKRLTVNYE   34 (89)
T ss_dssp             HHHHHHHSCCEEEEE
T ss_pred             HHHHHHHCCCCCCEE
T ss_conf             999999628876426


No 2  
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]}
Probab=6.01  E-value=74  Score=13.93  Aligned_cols=14  Identities=14%  Similarity=0.612  Sum_probs=8.3

Q ss_pred             ECHHHHCCCCEEEE
Q ss_conf             00553167872653
Q 537021.9.peg.6   19 INEYCRSNRNSITF   32 (37)
Q Consensus        19 ineycrsnrnsitf   32 (37)
                      +||||..++-++.|
T Consensus         5 L~E~~Qk~~~~~~~   18 (76)
T d1x48a1           5 VNSFAQKKKLSVNY   18 (76)
T ss_dssp             HHHHHHHTTCCEEE
T ss_pred             HHHHHHHHCCCCCC
T ss_conf             99999986899764


No 3  
>d2e50a1 d.305.1.1 (A:1-222) Protein SET {Human (Homo sapiens) [TaxId: 9606]}
Probab=5.93  E-value=1e+02  Score=13.22  Aligned_cols=24  Identities=25%  Similarity=0.396  Sum_probs=17.0

Q ss_pred             CCEEEEEEEEECHHHHCCCCEEEE
Q ss_conf             403799997500553167872653
Q 537021.9.peg.6    9 KSFSLIFQFTINEYCRSNRNSITF   32 (37)
Q Consensus         9 ksfslifqftineycrsnrnsitf   32 (37)
                      .+|.+.|.|.-|+|-....-..+|
T Consensus       120 ~~f~i~F~F~~N~yF~N~~L~K~y  143 (222)
T d2e50a1         120 SGYRIDFYFDENPYFENKVLSKEF  143 (222)
T ss_dssp             CCEEEEEEECSCSSBSCSEEEEEE
T ss_pred             CCEEEEEEECCCCCCCCCEEEEEE
T ss_conf             766999996898763577689999


No 4  
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]}
Probab=5.42  E-value=69  Score=14.08  Aligned_cols=14  Identities=29%  Similarity=0.577  Sum_probs=7.6

Q ss_pred             ECHHHHCCCCEEEE
Q ss_conf             00553167872653
Q 537021.9.peg.6   19 INEYCRSNRNSITF   32 (37)
Q Consensus        19 ineycrsnrnsitf   32 (37)
                      ++|||..++-+++|
T Consensus        13 L~E~~Qk~~~~~~y   26 (85)
T d1x49a1          13 LNKYRQMHGVAITY   26 (85)
T ss_dssp             HHHHHHHHTCCEEE
T ss_pred             HHHHHHHCCCCCEE
T ss_conf             99999866999758


No 5  
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]}
Probab=4.22  E-value=1e+02  Score=13.28  Aligned_cols=14  Identities=21%  Similarity=0.465  Sum_probs=8.0

Q ss_pred             ECHHHHCCCCEEEE
Q ss_conf             00553167872653
Q 537021.9.peg.6   19 INEYCRSNRNSITF   32 (37)
Q Consensus        19 ineycrsnrnsitf   32 (37)
                      ++|||..++....|
T Consensus         8 L~E~~qk~~~~p~y   21 (73)
T d2dixa1           8 LHEYGMKTKNIPVY   21 (73)
T ss_dssp             HHHHHHHTTCCCEE
T ss_pred             HHHHHHHCCCCCEE
T ss_conf             99999967989889


No 6  
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
Probab=3.08  E-value=2e+02  Score=11.93  Aligned_cols=18  Identities=22%  Similarity=0.015  Sum_probs=14.9

Q ss_pred             HHHHCCCCEEEEEEEEEC
Q ss_conf             344202403799997500
Q 537021.9.peg.6    3 NILKKAKSFSLIFQFTIN   20 (37)
Q Consensus         3 nilkkaksfslifqftin   20 (37)
                      .+++.-|||...+||+-.
T Consensus        58 dvl~~yksf~~~i~~~p~   75 (120)
T d1vjha_          58 EIQKYFKTLKGSIAVTPI   75 (120)
T ss_dssp             TGGGTEEEEEEEEEEEEC
T ss_pred             CCCCCEEEEEEEEEEEEC
T ss_conf             121031378999999966


No 7  
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
Probab=2.62  E-value=1.8e+02  Score=12.08  Aligned_cols=15  Identities=13%  Similarity=0.284  Sum_probs=9.2

Q ss_pred             ECHHHHCCCCEEEEC
Q ss_conf             005531678726531
Q 537021.9.peg.6   19 INEYCRSNRNSITFS   33 (37)
Q Consensus        19 ineycrsnrnsitfs   33 (37)
                      ++|||..+.-.+.|.
T Consensus        13 L~E~~q~~~~~~~y~   27 (76)
T d1ekza_          13 VHEIGIKRNMTVHFK   27 (76)
T ss_dssp             HHHHHHHTTCCCEEE
T ss_pred             HHHHHHHCCCCCEEE
T ss_conf             999999679897089


No 8  
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=2.53  E-value=1.7e+02  Score=12.23  Aligned_cols=10  Identities=30%  Similarity=0.341  Sum_probs=6.8

Q ss_pred             CEEEECCCCC
Q ss_conf             7265314769
Q 537021.9.peg.6   28 NSITFSSGEI   37 (37)
Q Consensus        28 nsitfssgei   37 (37)
                      .-.+|+|||+
T Consensus        35 g~~~~~sGEV   44 (47)
T d1biaa2          35 IIKPWMGGEI   44 (47)
T ss_dssp             EEEEESSCEE
T ss_pred             CEEEEEEEEE
T ss_conf             8899999989


No 9  
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=2.50  E-value=1.4e+02  Score=12.57  Aligned_cols=31  Identities=26%  Similarity=0.450  Sum_probs=17.9

Q ss_pred             CCCCEEEEE-EEEECHHHHCCCCE-------EEECCCCC
Q ss_conf             024037999-97500553167872-------65314769
Q 537021.9.peg.6    7 KAKSFSLIF-QFTINEYCRSNRNS-------ITFSSGEI   37 (37)
Q Consensus         7 kaksfslif-qftineycrsnrns-------itfssgei   37 (37)
                      ++++=...| --++-.|+-++-+.       ++|..|+|
T Consensus        16 ~~~~~~~~f~vra~~dy~~~~d~~~p~~~~~LsF~kGDi   54 (145)
T d1vyva1          16 RAKSKPVAFAVKTNVSYCGALDEDVPVPSSAVSFDAKDF   54 (145)
T ss_dssp             HHHTSCCCEEEEESSCBCTTSCCSCSSTTCBCCBCTTCE
T ss_pred             HCCCCCCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCE
T ss_conf             047898657998952047755776776663266768999


No 10 
>d1kshb_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.49  E-value=1.9e+02  Score=11.99  Aligned_cols=14  Identities=36%  Similarity=0.729  Sum_probs=6.2

Q ss_pred             HHCCCCEEEECCCC
Q ss_conf             31678726531476
Q 537021.9.peg.6   23 CRSNRNSITFSSGE   36 (37)
Q Consensus        23 crsnrnsitfssge   36 (37)
                      |+.-...|+||+|+
T Consensus        55 ~k~V~~~i~Fs~~e   68 (149)
T d1kshb_          55 CKAVSRELNFSSTE   68 (149)
T ss_dssp             CSCEEEEEEEEESS
T ss_pred             CCEECEEEEEECCC
T ss_conf             31012399996276


Done!