HHsearch alignment for GI: peg_75 and conserved domain: KOG1567

>KOG1567 consensus.
Probab=99.97  E-value=3.3e-31  Score=225.54  Aligned_cols=125  Identities=33%  Similarity=0.593  Sum_probs=117.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             96525578998987699999999999984222423302433799988789999999999887469872387989999999
Q 537021.9.peg.7    1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM   80 (136)
Q Consensus         1 M~G~~~~i~~I~RDE~lH~~~~~~l~~~l~~e~p~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yi   80 (136)
T Consensus       207 MPGLTfSNELIsrdeglh~dFacll~~~l~~-------kp~~~ri~eII~eAV~IEqef~~eaLPv~liGMN~~lM~qYI  279 (344)
T KOG1567         207 MPGLTFSNELISRDEGLHCDFACLLFSHLKK-------KPNEERIEEIITEAVEIEQEFLTEALPVNLIGMNCDLMSQYI  279 (344)
T ss_pred             CCCCCCCHHHHHHCCCCCCCHHHHHHHHHHH-------CCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCHHHHHHHH
T ss_conf             8764332135330247761199999999860-------897899999999999999999871165455345788999999


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCC
Q ss_conf             999999999769786789878886799997236678476732122224430266
Q 537021.9.peg.7   81 QFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAGLK  134 (136)
Q Consensus        81 ~y~an~rL~~lGl~~~f~~~~nP~~W~~~~~~~~~~~nFFE~r~~~Y~k~~~~~  134 (136)
T Consensus       280 EFVADrLL~~lG~~K~Yn~-~NPFdfME-nISl~GKTNFFEKrVseYQk~~vMs  331 (344)
T KOG1567         280 EFVADRLLVELGNEKYYNA-ENPFDFME-NISLAGKTNFFEKRVSEYQKAGVMS  331 (344)
T ss_pred             HHHHHHHHHHHCCCCEECC-CCCHHHHH-HHHHCCCCCHHHHHHHHHHHCHHCC
T ss_conf             9999999998485502057-88168888-7353254415776567765010024