HHsearch alignment for GI: peg_75 and conserved domain: cd07911

>cd07911 RNRR2_Rv0233_like Ribonucleotide Reductase R2-like protein, ferritin-like diiron-binding domain. Rv0233 is a Mycobacterium tuberculosis ribonucleotide reductase R2 protein with a heterodinuclear manganese/iron-carboxylate cofactor located in its metal center. The Rv0233-like family may represent a structural/functional counterpart of the evolutionary ancestor of the RNRR2's (Ribonucleotide Reductase, R2/beta subunit) and the bacterial multicomponent monooxygenases. RNRR2s belong to a broad superfamily of ferritin-like diiron-carboxylate proteins. The RNR protein catalyzes the conversion of ribonucleotides to deoxyribonucleotides and is found in prokaryotes and archaea. The catalytically active form of RNR is a proposed alpha2-beta2 tetramer. The homodimeric alpha subunit (R1) contains the active site and redox active cysteines as well as the allosteric binding sites.
Probab=99.76  E-value=9.4e-18  Score=137.27  Aligned_cols=95  Identities=20%  Similarity=0.200  Sum_probs=87.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             96525578998987699999999999984222423302433799988789999999999887469872387989999999
Q 537021.9.peg.7    1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM   80 (136)
Q Consensus         1 M~G~~~~i~~I~RDE~lH~~~~~~l~~~l~~e~p~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yi   80 (136)
T Consensus       176 m~G~~~~i~~I~RDE~~H~~fg~~l~~~l~~e~p~~~-d~~~e~~~el~~~av~~~-~~~~~~~~~~~~g~~~~~f~~Y~  253 (280)
T cd07911         176 LPGMQEGIRRLGDDESRHIAWGTFTCRRLVAADDANW-DVFEERMNELVPHALGLI-DEIFELYDEMPFGLDPDELMQYA  253 (280)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHH-HHHHHHHHHHHHHHHHHH-HHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             8778999999998899999999999999998695678-999999999999999999-99985156556688999999999


Q ss_pred             HHHHHHHHHHCCCCCCC
Q ss_conf             99999999976978678
Q 537021.9.peg.7   81 QFIANRRCHQIGLEPLF   97 (136)
Q Consensus        81 ~y~an~rL~~lGl~~~f   97 (136)
T Consensus       254 ~~~a~~rLg~i~~~~~~  270 (280)
T cd07911         254 VDQFQRRLGYIERARGQ  270 (280)
T ss_pred             HHHHHHHHHHHHHHCCC
T ss_conf             99999874488785299