HHsearch results for GI: peg_75 and protein with PDBid: 2rcc_A

>2rcc_A Ribonucleoside-diphosphate reductase subunit beta; NP_241368.1, putative class I ribonucleotide reductase, ribonucleotide reductase; HET: MSE PGE PG4; 1.90A {Bacillus halodurans c-125}
Probab=100.00  E-value=1.6e-37  Score=265.50  Aligned_cols=136  Identities=29%  Similarity=0.505  Sum_probs=127.5

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
Q ss_conf             96525578998987699999999999984222423302433799988789999999999887469872387989999999
Q 537021.9.peg.7    1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYM   80 (136)
Q Consensus         1 M~G~~~~i~~I~RDE~lH~~~~~~l~~~l~~e~p~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~~~~~~Yi   80 (136)
                      |+|++++|+||+|||++|+.|++.|++++++++|+++++++++.+++++++||++|++|++++|+.+++|||++++++||
T Consensus       206 m~g~~~~i~~I~RDE~lH~~~~~~l~~~l~~e~~~~~~~~~~~~i~~~~~eave~E~~~~~~~~~~~~~Gl~~e~~~~yi  285 (346)
T 2rcc_A          206 MVSTSTMINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWFRYIIGDKIPGINPEDMETYI  285 (346)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCGGGCSHHHHHHHHHHHHHHHHHHHHHHHHHTTTCSTTCCHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             98789999999843768899999999998762661025678999999999999999999999818776888899999999


Q ss_pred             HHHHHHHHHHCCCCCCCCC-CCCCHHHHHHHHCCC-CCCCCCCCCHHHHHHHCCC-CCC
Q ss_conf             9999999997697867898-788867999972366-7847673212222443026-689
Q 537021.9.peg.7   81 QFIANRRCHQIGLEPLFKY-TENPFPWMSEVIDLK-KEKNFFETRVTEYQQGAGL-KWD  136 (136)
Q Consensus        81 ~y~an~rL~~lGl~~~f~~-~~nP~~W~~~~~~~~-~~~nFFE~r~~~Y~k~~~~-~~D  136 (136)
                      +|+||+||.+||++++|+. .+||+|||++++++. +++||||+|+|+|+||+.. .||
T Consensus       286 ~y~an~~L~~lG~~~~f~~~~~nP~~w~~~~~~~~~~~~nFFE~~~t~Y~k~~~~~~~D  344 (346)
T 2rcc_A          286 SFIANKRAVQLGMEKPYPEIKHNPMKWIRAYEDVNSGKSDFFEQKSRQYAKVSADNGFD  344 (346)
T ss_dssp             HHHHHHHHHHTTCCCSCTTCCSCSCTTC-------------------------------
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCCC
T ss_conf             99999999977999999877789588999864347652588889778753267778866