BLAST/PSIBLAST alignment of GI: peg_75 and GI: 209885874 at iteration 1
>gi|209885874|ref|YP_002289731.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha carboxidovorans OM5] Length = 377
>gi|209874070|gb|ACI93866.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha carboxidovorans OM5] Length = 377
 Score =  228 bits (581), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/136 (75%), Positives = 113/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK+ENPHLWTK FQ + R M+ EA  LE AY 
Sbjct: 242 MVGIAEQYQYILRDESIHLNFGIDVINQIKLENPHLWTKAFQDEVRGMISEAAGLEAAYG 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM FIANRRC QIGL P+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 302 RDTMPRGFLGLNAALCEQYMHFIANRRCAQIGLAPVFAETENPFPWMSEAMDLKKEKNFF 361

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 362 ETRVIEYQNGGALSWD 377