BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.75_1
         (136 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040522|gb|ACT57318.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040641|gb|ACT57437.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 352

 Score =  288 bits (736), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 135/136 (99%), Positives = 135/136 (99%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA
Sbjct: 217 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 276

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF
Sbjct: 277 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 336

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQQGA LKWD
Sbjct: 337 ETRVTEYQQGAELKWD 352


>gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254039813|gb|ACT56609.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040683|gb|ACT57479.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 125

 Score =  263 bits (672), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 124/125 (99%), Positives = 124/125 (99%)

Query: 12  MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 71
           MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL
Sbjct: 1   MRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGL 60

Query: 72  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 131
           NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA
Sbjct: 61  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 120

Query: 132 GLKWD 136
            LKWD
Sbjct: 121 ELKWD 125


>gi|315122301|ref|YP_004062790.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495703|gb|ADR52302.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 372

 Score =  231 bits (590), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 120/136 (88%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYIMRDES+HLNFGID+INQIKIENPHLWT++FQQ+ R ML EA LLE+AY 
Sbjct: 237 MVGIAEQYQYIMRDESVHLNFGIDMINQIKIENPHLWTEDFQQEVRKMLQEAALLEVAYG 296

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMPK F+G+NA  CE+YM FI NRRC QIGL+P+F+ TENPFPWMSEVIDL+KEKNFF
Sbjct: 297 KDTMPKPFLGINANLCEKYMYFITNRRCTQIGLDPVFEKTENPFPWMSEVIDLQKEKNFF 356

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ+G  L WD
Sbjct: 357 ETRVTEYQKGTSLDWD 372


>gi|209885874|ref|YP_002289731.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
 gi|209874070|gb|ACI93866.1| ribonucleoside-diphosphate reductase, beta subunit [Oligotropha
           carboxidovorans OM5]
          Length = 377

 Score =  228 bits (581), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/136 (75%), Positives = 113/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK+ENPHLWTK FQ + R M+ EA  LE AY 
Sbjct: 242 MVGIAEQYQYILRDESIHLNFGIDVINQIKLENPHLWTKAFQDEVRGMISEAAGLEAAYG 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM FIANRRC QIGL P+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 302 RDTMPRGFLGLNAALCEQYMHFIANRRCAQIGLAPVFAETENPFPWMSEAMDLKKEKNFF 361

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 362 ETRVIEYQNGGALSWD 377


>gi|72163401|ref|YP_291058.1| ribonucleotide-diphosphate reductase subunit beta [Thermobifida
           fusca YX]
 gi|71917133|gb|AAZ57035.1| ribonucleoside-diphosphate reductase [Thermobifida fusca YX]
          Length = 354

 Score =  225 bits (573), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/136 (75%), Positives = 116/136 (85%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIKIENPHLWT+EFQ + RTML EA  LE AY 
Sbjct: 219 MVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWTEEFQDEVRTMLIEACELEAAYG 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ETMP+G +GLNA  CEQYM+FI +RR  Q+GL P+F  TENPFPWMSE++DLKKEKNFF
Sbjct: 279 RETMPRGILGLNAKLCEQYMRFITDRRAEQLGLAPIFGETENPFPWMSEMMDLKKEKNFF 338

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G+GL WD
Sbjct: 339 ETRVIEYQTGSGLSWD 354


>gi|256377255|ref|YP_003100915.1| ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
 gi|255921558|gb|ACU37069.1| Ribonucleoside-diphosphate reductase [Actinosynnema mirum DSM
           43827]
          Length = 358

 Score =  224 bits (571), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 112/136 (82%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID INQIKIENPHLW + FQ + RTML EA  LEIAY 
Sbjct: 223 MVGIAEQYQYILRDESIHLNFGIDAINQIKIENPHLWGEAFQAEVRTMLAEACELEIAYG 282

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +GLNA  CEQYM+FI NRRC Q+GLEP+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 283 RDTMPNGLLGLNAELCEQYMRFITNRRCAQLGLEPVFAATENPFPWMSEAVDLKKEKNFF 342

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEY  G  L WD
Sbjct: 343 ETRVTEYASGGTLDWD 358


>gi|134097869|ref|YP_001103530.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|291007412|ref|ZP_06565385.1| ribonucleotide-diphosphate reductase subunit beta
           [Saccharopolyspora erythraea NRRL 2338]
 gi|133910492|emb|CAM00605.1| ribonucleoside-diphosphate reductase, beta subunit
           [Saccharopolyspora erythraea NRRL 2338]
          Length = 360

 Score =  224 bits (571), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID INQIKIENPHLWT EFQ++ RTML EA  LE+AY 
Sbjct: 225 MVGIAEQYQYILRDESIHLNFGIDCINQIKIENPHLWTPEFQEEVRTMLTEACELEVAYG 284

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA  CE+YM+FI NRRC Q+GLEP+F  T NPFPWMSE +DLKKEKNFF
Sbjct: 285 RDTMPRGILGLNAGLCEEYMRFITNRRCAQLGLEPVFPETANPFPWMSEAMDLKKEKNFF 344

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 345 ETRVIEYQSGGALDWD 360


>gi|226227154|ref|YP_002761260.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
 gi|226090345|dbj|BAH38790.1| ribonucleoside-diphosphate reductase beta subunit [Gemmatimonas
           aurantiaca T-27]
          Length = 371

 Score =  224 bits (570), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 113/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK+ENPHLW+  FQ++ R ML EA  LE+AY 
Sbjct: 236 MVGIAEQYQYILRDESIHLNFGIDVINQIKVENPHLWSAAFQEEVRQMLAEACELEVAYG 295

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CE YM FI NRRC Q+GL P+F  T+NPFPWMSE IDLKKEKNFF
Sbjct: 296 RDTMPRGFLGLNAALCETYMHFITNRRCAQLGLAPVFPETDNPFPWMSEAIDLKKEKNFF 355

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  LKWD
Sbjct: 356 ETRVIEYQNGGALKWD 371


>gi|110635036|ref|YP_675244.1| ribonucleotide-diphosphate reductase subunit beta [Mesorhizobium
           sp. BNC1]
 gi|110286020|gb|ABG64079.1| ribonucleotide reductase [Chelativorans sp. BNC1]
          Length = 369

 Score =  223 bits (569), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 113/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK ENPHLWT EFQ++ R ML +A  LE AY 
Sbjct: 234 MVGIAEQYQYILRDESIHLNFGIDVINQIKHENPHLWTPEFQEELRRMLKDAAELEAAYG 293

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM FIANRRC Q+GL P+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 294 RDTMPRGFLGLNAGQCEQYMHFIANRRCAQLGLPPVFPETENPFPWMSEAMDLKKEKNFF 353

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 354 ETRVIEYQNGGALSWD 369


>gi|92119123|ref|YP_578852.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           hamburgensis X14]
 gi|91802017|gb|ABE64392.1| Ribonucleoside-diphosphate reductase [Nitrobacter hamburgensis X14]
          Length = 416

 Score =  222 bits (566), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/136 (72%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIKIENPHLW+K FQ++ R ML  A  LE AY 
Sbjct: 281 MVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSKPFQEEVRAMLKNAAELEAAYG 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM  IANRRC Q+GL P+F   +NPFPWMSE +DLKKEKNFF
Sbjct: 341 RDTMPRGFLGLNAALCEQYMHVIANRRCAQLGLAPVFAEADNPFPWMSEAMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQNGGALAWD 416


>gi|85714830|ref|ZP_01045816.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
 gi|85698316|gb|EAQ36187.1| ribonucleotide reductase [Nitrobacter sp. Nb-311A]
          Length = 389

 Score =  221 bits (563), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/136 (72%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+GIAEQYQYI+RDES+HLNFGIDVINQIKIENPHLWTK FQ + R ML  A  LE AY 
Sbjct: 254 MIGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWTKTFQDEVRAMLKNAAELEAAYG 313

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CE YM  IANRRC Q+GL P+F  T+NPFPWMSE +DLKKEKNFF
Sbjct: 314 RDTMPRGFLGLNAALCETYMHVIANRRCAQLGLAPVFAETDNPFPWMSEAMDLKKEKNFF 373

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 374 ETRVIEYQNGGALAWD 389


>gi|299134880|ref|ZP_07028072.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
 gi|298590690|gb|EFI50893.1| Ribonucleoside-diphosphate reductase [Afipia sp. 1NLS2]
          Length = 373

 Score =  221 bits (563), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 112/136 (82%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK+EN HLWTK FQ+  R M+ +A  LE AY 
Sbjct: 238 MVGIAEQYQYILRDESIHLNFGIDVINQIKLENQHLWTKAFQEDVRGMIRDAAELEAAYG 297

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM FIANRRC QIGL P+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 298 RDTMPRGFLGLNAALCEQYMHFIANRRCAQIGLTPVFPETENPFPWMSEAMDLKKEKNFF 357

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 358 ETRVIEYQNGGALSWE 373


>gi|90425007|ref|YP_533377.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris BisB18]
 gi|90107021|gb|ABD89058.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           BisB18]
          Length = 386

 Score =  221 bits (562), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIKIENP LWT  FQ++ R ML EA  LE AY+
Sbjct: 251 MVGIAEQYQYILRDESIHLNFGIDVINQIKIENPKLWTAGFQEELRGMLQEAAELEAAYS 310

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CEQYM FI NRRC Q+GL P+F   ENPFPWMSE +DLKKEKNFF
Sbjct: 311 RDTMPRGFLGLNAALCEQYMHFITNRRCAQLGLAPIFAEVENPFPWMSETMDLKKEKNFF 370

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 371 ETRVIEYQNGGALTWD 386


>gi|297563527|ref|YP_003682501.1| ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296847975|gb|ADH69995.1| Ribonucleoside-diphosphate reductase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 360

 Score =  220 bits (560), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 114/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIKIENPHLW++EFQ + R ML EA  LE+AY 
Sbjct: 225 MVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEEFQAEVRQMLTEACELEVAYG 284

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ETMP+G +GLNA  CE+YM FI +RR  QIGL P+F  TENPFPWMSE++DL+KEKNFF
Sbjct: 285 RETMPRGVLGLNAELCEKYMHFITDRRAEQIGLAPIFGETENPFPWMSEMMDLQKEKNFF 344

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G GL WD
Sbjct: 345 ETRVIEYQTGGGLDWD 360


>gi|324998522|ref|ZP_08119634.1| ribonucleoside-diphosphate reductase beta chain [Pseudonocardia sp.
           P1]
          Length = 358

 Score =  219 bits (558), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 114/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG+AEQYQYI+RDES+HLNFGID INQIKIENPHLWT+EF  + R MLHEA  LE+AYA
Sbjct: 223 MVGVAEQYQYILRDESIHLNFGIDCINQIKIENPHLWTEEFAAEIRAMLHEACELEVAYA 282

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GL A SCEQY++FI +RR  QIGL PLF   +NPFPWMSE +DL+KEKNFF
Sbjct: 283 RDTMPRGMLGLTAESCEQYLRFITDRRAEQIGLAPLFGQADNPFPWMSEAMDLRKEKNFF 342

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEY+ G  L+WD
Sbjct: 343 ETRVTEYRTGGSLEWD 358


>gi|115525181|ref|YP_782092.1| ribonucleotide reductase [Rhodopseudomonas palustris BisA53]
 gi|115519128|gb|ABJ07112.1| ribonucleotide reductase [Rhodopseudomonas palustris BisA53]
          Length = 223

 Score =  218 bits (555), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 99/136 (72%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID+INQIKIENP LWT  FQ++ R ML EA  LE AY 
Sbjct: 88  MVGIAEQYQYILRDESIHLNFGIDIINQIKIENPELWTAGFQEELRGMLREAAELEAAYC 147

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF GLNA  CEQYM FI NRRC Q+GL P+F   ENPFPWMSE +DLKKEKNFF
Sbjct: 148 RDTMPRGFFGLNAALCEQYMHFITNRRCAQLGLAPIFAEVENPFPWMSETMDLKKEKNFF 207

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 208 ETRVIEYQNGGALTWD 223


>gi|75677068|ref|YP_319489.1| ribonucleotide-diphosphate reductase subunit beta [Nitrobacter
           winogradskyi Nb-255]
 gi|74421938|gb|ABA06137.1| ribonucleotide reductase [Nitrobacter winogradskyi Nb-255]
          Length = 391

 Score =  218 bits (554), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID+INQIKIENPHLW+K FQ++ R ML  A  LE AY 
Sbjct: 256 MVGIAEQYQYILRDESIHLNFGIDIINQIKIENPHLWSKPFQEEVRAMLKNAADLEAAYG 315

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+GF+GLNA  CE YM  IANRRC Q+GL P+F   +NPFPWMSE +DLKKEKNFF
Sbjct: 316 RDTMPRGFLGLNATLCETYMHVIANRRCAQLGLAPVFPDADNPFPWMSEAMDLKKEKNFF 375

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 376 ETRVIEYQNGGALAWD 391


>gi|257055668|ref|YP_003133500.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
 gi|256585540|gb|ACU96673.1| ribonucleotide reductase, beta subunit [Saccharomonospora viridis
           DSM 43017]
          Length = 349

 Score =  217 bits (552), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 114/136 (83%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFG+D INQIK ENPHLWT EFQQ+ R ML EA  LE+AYA
Sbjct: 214 MVGIAEQYQYILRDESIHLNFGVDCINQIKAENPHLWTPEFQQQVRDMLVEACELEVAYA 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           H+TMP+  +GL+A  CEQYM FI +RR  Q+GL+P+F   ENPFPWMSEVIDL+KEKNFF
Sbjct: 274 HDTMPRPMLGLSAELCEQYMHFITDRRAAQLGLDPVFGERENPFPWMSEVIDLRKEKNFF 333

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVT+Y+ GA L WD
Sbjct: 334 ETRVTDYRSGAALAWD 349


>gi|300784783|ref|YP_003765074.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
 gi|299794297|gb|ADJ44672.1| ribonucleoside-diphosphate reductase beta chain [Amycolatopsis
           mediterranei U32]
          Length = 357

 Score =  216 bits (551), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID INQIKIENPHLWT+EFQ + R ML EA  LE+ YA
Sbjct: 222 MVGIAEQYQYILRDESIHLNFGIDCINQIKIENPHLWTEEFQAEVRGMLKEACELEVKYA 281

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GL+A  CEQYM F+ +RR  QIGL P+F  TENPFPWMSE +DLKKEKNFF
Sbjct: 282 RDTMPRGMLGLSAQLCEQYMHFVTDRRAQQIGLAPIFGETENPFPWMSEAMDLKKEKNFF 341

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 342 ETRVIEYQSGGALDWD 357


>gi|261855609|ref|YP_003262892.1| ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
 gi|261836078|gb|ACX95845.1| Ribonucleoside-diphosphate reductase [Halothiobacillus neapolitanus
           c2]
          Length = 398

 Score =  215 bits (548), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 98/135 (72%), Positives = 110/135 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GIAEQYQYIMRDES+H+NFGIDVINQIKIENPHLWT++F+ +   ML EA  LEIAYA
Sbjct: 264 MTGIAEQYQYIMRDESIHMNFGIDVINQIKIENPHLWTEDFKAEVTRMLKEAAELEIAYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +GLNA  C +Y+ FIANRRC+QIGL  LF    NPFPWMSEVIDLKKEKNFF
Sbjct: 324 RDTMPHGLLGLNAEMCAEYLHFIANRRCNQIGLAELFPGATNPFPWMSEVIDLKKEKNFF 383

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 384 ETRVTDYQTGGALNW 398


>gi|302525965|ref|ZP_07278307.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
 gi|302434860|gb|EFL06676.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. AA4]
          Length = 357

 Score =  214 bits (544), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGID INQIKIENPHLWT+EFQ + R ML EA  LE+ YA
Sbjct: 222 MVGIAEQYQYILRDESIHLNFGIDCINQIKIENPHLWTEEFQAEVRGMLQEACELEVKYA 281

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GL+A  CEQYM FI +RR  QIGL P++   ENPFPWMSE +DLKKEKNFF
Sbjct: 282 RDTMPRGMLGLSADLCEQYMHFITDRRAQQIGLPPIYGENENPFPWMSEAMDLKKEKNFF 341

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 342 ETRVIEYQSGGALDWD 357


>gi|192291019|ref|YP_001991624.1| ribonucleotide-diphosphate reductase subunit beta [Rhodopseudomonas
           palustris TIE-1]
 gi|192284768|gb|ACF01149.1| Ribonucleoside-diphosphate reductase [Rhodopseudomonas palustris
           TIE-1]
          Length = 373

 Score =  211 bits (537), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GIAEQYQYI+RDES+HLNFGIDVINQIK+EN  +WT  FQ   R M+H+A  LE AY 
Sbjct: 238 MTGIAEQYQYILRDESIHLNFGIDVINQIKLENAAVWTASFQDDIRGMIHDAAELEAAYG 297

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +GLNA  CE YM FIANRRC Q+GL P+F  T+NPFPWMSE +DLKKEKNFF
Sbjct: 298 RDTMPHGLLGLNAALCESYMHFIANRRCVQLGLRPVFAETDNPFPWMSETMDLKKEKNFF 357

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 358 ETRVIEYQNGGALDWD 373


>gi|300022335|ref|YP_003754946.1| ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524156|gb|ADJ22625.1| Ribonucleoside-diphosphate reductase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 374

 Score =  210 bits (535), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 96/136 (70%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDES+HLNFGIDVINQIK EN HLW+K FQ + R ML +A  LE AY 
Sbjct: 239 MVGIAEQYQYILRDESIHLNFGIDVINQIKAENAHLWSKAFQDEVRGMLRDAAQLEAAYG 298

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +GLN    EQYM+FIANRRC Q+GL P+FK  ENPFPWMSE +DLKKEKNFF
Sbjct: 299 RDTMPTGLLGLNPGLTEQYMEFIANRRCAQLGLTPVFKDRENPFPWMSEAMDLKKEKNFF 358

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 359 ETRVIEYQNGGALSWE 374


>gi|284032753|ref|YP_003382684.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
 gi|283812046|gb|ADB33885.1| Ribonucleoside-diphosphate reductase [Kribbella flavida DSM 17836]
          Length = 354

 Score =  210 bits (534), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGIAEQYQYI+RDESLHLNFGID INQIK+ENPHLWT  FQ + R ML EA  LE+AY 
Sbjct: 219 MVGIAEQYQYILRDESLHLNFGIDCINQIKLENPHLWTPAFQAEVRRMLTEACELEVAYG 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
             T+P G +GL A  CEQYM FI +RR  Q+GL PLF  T NPF WMSEV+DLKKEKNFF
Sbjct: 279 RATLPNGMLGLTAELCEQYMHFITDRRAEQLGLAPLFGETRNPFGWMSEVMDLKKEKNFF 338

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G GL WD
Sbjct: 339 ETRVIEYQSGGGLSWD 354


>gi|300113307|ref|YP_003759882.1| ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
 gi|299539244|gb|ADJ27561.1| Ribonucleoside-diphosphate reductase [Nitrosococcus watsonii C-113]
          Length = 412

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYIMRDES+H+NFGIDVINQIK+ENPHLW+  F+Q++  M+ EA  LE  YA
Sbjct: 277 MTGTAEQFQYIMRDESMHMNFGIDVINQIKLENPHLWSDSFKQETLRMIQEAVSLETQYA 336

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           H+TMP+G +GLNAP  E+Y++FIANRRC QIGL   +    NPFPWMSEV+DLKKEKNFF
Sbjct: 337 HDTMPRGVLGLNAPMFEEYLKFIANRRCAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFF 396

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 397 ETRVTEYQTGGALSWD 412


>gi|77165986|ref|YP_344511.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosococcus
           oceani ATCC 19707]
 gi|254436303|ref|ZP_05049809.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
 gi|76884300|gb|ABA58981.1| Ribonucleoside-diphosphate reductase [Nitrosococcus oceani ATCC
           19707]
 gi|207087993|gb|EDZ65266.1| ribonucleoside-diphosphate reductase, beta subunit [Nitrosococcus
           oceani AFC27]
          Length = 412

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYIMRDES+H+NFGIDVINQIK+ENPHLW+  F+Q++  M+ EA  LE  YA
Sbjct: 277 MTGTAEQFQYIMRDESMHMNFGIDVINQIKLENPHLWSDSFKQETLRMIQEAVSLETQYA 336

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           H+TMP+G +GLNAP  E+Y++FIANRRC QIGL   +    NPFPWMSEV+DLKKEKNFF
Sbjct: 337 HDTMPRGVLGLNAPMFEEYLKFIANRRCAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFF 396

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 397 ETRVTEYQTGGALSWD 412


>gi|292490774|ref|YP_003526213.1| ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
 gi|291579369|gb|ADE13826.1| Ribonucleoside-diphosphate reductase [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  208 bits (530), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYIMRDES+H+NFGIDVINQIKIENPHLWT  F+Q++  M+ EA  LE  YA
Sbjct: 280 MTGTAEQFQYIMRDESMHMNFGIDVINQIKIENPHLWTDSFKQETIQMIREAVSLETQYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           ++TMP+G +GLNAP  ++Y++FIANRRC QIGL   +    NPFPWMSE++DLKKEKNFF
Sbjct: 340 YDTMPRGVLGLNAPMFDEYLKFIANRRCAQIGLPEQYPGASNPFPWMSEILDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  LKWD
Sbjct: 400 ETRVTEYQTGGALKWD 415


>gi|220935777|ref|YP_002514676.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997087|gb|ACL73689.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 408

 Score =  207 bits (527), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 91/136 (66%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+H+NFGIDVINQIK+ENPHLWT  F+++ RTM+ +A  LE  YA
Sbjct: 273 MTGVAEQFQYILRDESMHMNFGIDVINQIKVENPHLWTAAFKEEMRTMIRDAVELEAQYA 332

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRRC QIGL  ++   ENPFPWMSEV+DLKKEKNFF
Sbjct: 333 RDTMPRGVLGMNAAMFEEYLHFIANRRCAQIGLAEIYPGAENPFPWMSEVLDLKKEKNFF 392

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 393 ETRVTEYQTGGALSWD 408


>gi|114321252|ref|YP_742935.1| ribonucleotide-diphosphate reductase subunit beta [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|114227646|gb|ABI57445.1| Ribonucleoside-diphosphate reductase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 354

 Score =  206 bits (525), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 92/136 (67%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GIAE YQYI+RDES+HLNFGIDVINQI+ ENP LWT +F+Q+  TML EA  LE+AYA
Sbjct: 219 MTGIAEMYQYILRDESIHLNFGIDVINQIRHENPELWTNDFEQEVLTMLREAVELEVAYA 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA  CE+YM FI NRRC Q+GL+ L+    NPFPWMSEV+DL+KEKNFF
Sbjct: 279 RDTMPRGMLGLNADMCEEYMHFITNRRCAQLGLKELYPGATNPFPWMSEVMDLQKEKNFF 338

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVT+Y+ G  L+WD
Sbjct: 339 ETRVTDYRTGGALQWD 354


>gi|289208615|ref|YP_003460681.1| ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
 gi|288944246|gb|ADC71945.1| Ribonucleoside-diphosphate reductase [Thioalkalivibrio sp. K90mix]
          Length = 412

 Score =  206 bits (524), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+H+NFGIDVINQIK+ENPHLWT+EF+ + RT++ +A  LE  YA
Sbjct: 277 MTGVAEQFQYILRDESMHMNFGIDVINQIKVENPHLWTEEFKNEMRTLISDAVELEAQYA 336

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRRC QIGL  ++   +NPFPWMSEV+DLKKEKNFF
Sbjct: 337 RDTMPRGVLGMNAQMFEEYLHFIANRRCAQIGLAEMYPGADNPFPWMSEVLDLKKEKNFF 396

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 397 ETRVTEYQTGGALSWD 412


>gi|288941383|ref|YP_003443623.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
 gi|288896755|gb|ADC62591.1| Ribonucleoside-diphosphate reductase [Allochromatium vinosum DSM
           180]
          Length = 458

 Score =  204 bits (519), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+Q+   M+ EA  LE  YA
Sbjct: 323 MTGTAEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFRQELVGMIREAVELEARYA 382

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           H+TMP+G +GLNA   E Y+ FIANRRC QIGL   +    NPFPWMSEV+DLKKEKNFF
Sbjct: 383 HDTMPRGVLGLNAQMFEDYLHFIANRRCAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFF 442

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 443 ETRVTEYQTGGALNWD 458


>gi|192360823|ref|YP_001982048.1| ribonucleotide-diphosphate reductase subunit beta [Cellvibrio
           japonicus Ueda107]
 gi|190686988|gb|ACE84666.1| ribonucleoside reductase, beta subunit [Cellvibrio japonicus
           Ueda107]
          Length = 429

 Score =  204 bits (518), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT EFQQ+   M+ E T LEI YA
Sbjct: 294 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTAEFQQEVLQMILEGTELEIQYA 353

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ++MP+G +G+NA   E+Y+ FIANRRC Q+GL+  F   +NPFPWMSE++DL+KEKNFF
Sbjct: 354 RDSMPRGVLGMNAAMMEEYLHFIANRRCAQLGLKEQFPGAQNPFPWMSEIMDLRKEKNFF 413

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 414 ETRVIEYQTGGALSWD 429


>gi|300703002|ref|YP_003744604.1| ribonucleoside diphosphate reductase 1 subunit beta, ferritin-like
           [Ralstonia solanacearum CFBP2957]
 gi|299070665|emb|CBJ41960.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CFBP2957]
          Length = 402

 Score =  204 bits (518), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/136 (67%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 387 ETRVIEYQTGGALSWD 402


>gi|83746810|ref|ZP_00943858.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|207721465|ref|YP_002251905.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
 gi|83726579|gb|EAP73709.1| Ribonucleoside-diphosphate reductase beta chain [Ralstonia
           solanacearum UW551]
 gi|206586625|emb|CAQ17211.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum MolK2]
          Length = 402

 Score =  204 bits (518), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 92/136 (67%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 387 ETRVIEYQTGGALSWD 402


>gi|254516739|ref|ZP_05128798.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
 gi|219675162|gb|EED31529.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR5-3]
          Length = 441

 Score =  203 bits (517), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 91/136 (66%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT+EF+Q++  M+ E T LEI YA
Sbjct: 306 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTEEFKQEAIQMILEGTQLEIEYA 365

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  QIGL   F   +NPFPWMSE++DL+KEKNFF
Sbjct: 366 RDTMPRGVLGMNAAMMEEYLQFIANRRLSQIGLPEQFPGVQNPFPWMSEIMDLRKEKNFF 425

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 426 ETRVIEYQTGGALSWD 441


>gi|207744360|ref|YP_002260752.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595765|emb|CAQ62692.1| transmembrane ribonucleoside reductase (small chain) protein
           [Ralstonia solanacearum IPO1609]
          Length = 410

 Score =  203 bits (517), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/136 (67%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 275 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 334

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 335 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFF 394

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 395 ETRVIEYQTGGALSWD 410


>gi|330983931|gb|EGH82034.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 388

 Score =  203 bits (516), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           +VG+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT E ++++  M+ + T LEIAYA
Sbjct: 253 LVGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTDELKREATVMIIQGTQLEIAYA 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  QIGL  ++   +NPFPWMSE++DLKKEKNFF
Sbjct: 313 RDTMPRGVLGMNAAMMEEYLQFIANRRLTQIGLPEVYAGAKNPFPWMSEIMDLKKEKNFF 372

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 373 ETRVIEYQTGGALSWD 388


>gi|30250346|ref|NP_842416.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           europaea ATCC 19718]
 gi|30181141|emb|CAD86334.1| Ribonucleotide reductase [Nitrosomonas europaea ATCC 19718]
          Length = 382

 Score =  203 bits (516), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 91/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLWT+EF+++   ++ +A  LE  YA
Sbjct: 247 MTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLWTREFREEISALMRKAVELEYRYA 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF    NPFPWMSE+IDLKKEKNFF
Sbjct: 307 EDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLFPEAGNPFPWMSEMIDLKKEKNFF 366

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 367 ETRVIEYQTGGVLSWD 382


>gi|114332419|ref|YP_748641.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosomonas
           eutropha C91]
 gi|114309433|gb|ABI60676.1| Ribonucleoside-diphosphate reductase [Nitrosomonas eutropha C91]
          Length = 377

 Score =  202 bits (514), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDVINQIK+ENPHLWT+EF+++   ++ +A  LE  YA
Sbjct: 242 MTGAAEQYQYILRDESMHCNFGIDVINQIKLENPHLWTREFREEISALMRKAVELEYRYA 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  ++Y++FI NRR HQIGL+PLF    NPFPWMSE++DLKKEKNFF
Sbjct: 302 EDTMPRGVLGLNAPMFKEYLRFIINRRSHQIGLDPLFPEAGNPFPWMSEMVDLKKEKNFF 361

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 362 ETRVIEYQTGGVLSWD 377


>gi|307546480|ref|YP_003898959.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
 gi|307218504|emb|CBV43774.1| ribonucleotide-diphosphate reductase subunit beta [Halomonas
           elongata DSM 2581]
          Length = 415

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFG+D+INQIKIENPHLWT EFQ +   M+ E T LEIAYA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGVDMINQIKIENPHLWTPEFQDECTQMILEGTELEIAYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ++MP+G +G+NA   E+Y+ FI NRR  QIGL+  F   +NPFPWMSE+IDL+KEKNFF
Sbjct: 340 RDSMPRGVLGMNAAIMEEYLHFICNRRLAQIGLKEQFPGAQNPFPWMSEIIDLRKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 400 ETRVTEYQVGGALSWD 415


>gi|82703584|ref|YP_413150.1| ribonucleotide-diphosphate reductase subunit beta [Nitrosospira
           multiformis ATCC 25196]
 gi|82411649|gb|ABB75758.1| Ribonucleoside-diphosphate reductase [Nitrosospira multiformis ATCC
           25196]
          Length = 408

 Score =  202 bits (513), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDV+NQIK+ENPHLWTKEF+ +   ++ +A  LE  YA
Sbjct: 273 MTGSAEQYQYILRDESMHCNFGIDVVNQIKMENPHLWTKEFRSEISALMQKAVELEYRYA 332

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  ++Y+++IANRRC QIGL+ L+    NPFPWMSE+IDLKKEKNFF
Sbjct: 333 EDTMPRGVLGLNAPMFKEYLRYIANRRCQQIGLDILYPGASNPFPWMSEMIDLKKEKNFF 392

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 393 ETRVTEYQTGGVLNWD 408


>gi|33593916|ref|NP_881560.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           pertussis Tohama I]
 gi|33598411|ref|NP_886054.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           parapertussis 12822]
 gi|33603351|ref|NP_890911.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           bronchiseptica RB50]
 gi|33563990|emb|CAE43255.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           pertussis Tohama I]
 gi|33574540|emb|CAE39187.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           parapertussis]
 gi|33577475|emb|CAE34740.1| ribonucleoside-diphosphate reductase beta chain [Bordetella
           bronchiseptica RB50]
          Length = 398

 Score =  201 bits (512), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN IK+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 263 MTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWTPEFREEIRELFRKAVELEYAYA 322

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPLF   ENPFPWM+E+IDLKKE+NFF
Sbjct: 323 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLFPQEENPFPWMAEMIDLKKERNFF 382

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 383 ETRVIEYQTGGTLSWE 398


>gi|53804295|ref|YP_114081.1| ribonucleotide-diphosphate reductase subunit beta [Methylococcus
           capsulatus str. Bath]
 gi|53758056|gb|AAU92347.1| ribonucleoside-diphosphate reductase, beta subunit [Methylococcus
           capsulatus str. Bath]
          Length = 403

 Score =  201 bits (512), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 91/136 (66%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYIMRDES+H+NFGIDVINQIK+ENPHLWT  F+ +   M+ EA  +E  YA
Sbjct: 268 MTGTAEQFQYIMRDESMHMNFGIDVINQIKVENPHLWTDGFKVEMVQMIREAVDIETQYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           ++TMP+G +GLNAP  ++Y+QFIANRRC QIGL   +    NPFPWMSEV+DLKKEKNFF
Sbjct: 328 YDTMPRGILGLNAPMFKEYLQFIANRRCAQIGLPEQYPGASNPFPWMSEVLDLKKEKNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 388 ETRVTEYQTGGTLSWD 403


>gi|92112799|ref|YP_572727.1| ribonucleotide-diphosphate reductase subunit beta [Chromohalobacter
           salexigens DSM 3043]
 gi|91795889|gb|ABE58028.1| Ribonucleoside-diphosphate reductase [Chromohalobacter salexigens
           DSM 3043]
          Length = 420

 Score =  201 bits (511), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFG+D+INQIKIENPHLWT EFQ +   M+ E T LEIAYA
Sbjct: 285 MTGVAEQFQYILRDESMHLNFGVDMINQIKIENPHLWTPEFQDEVTQMIIEGTELEIAYA 344

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ++MP+G +G+NA   E+Y+ FI NRR  QIGL+  +   ENPFPWMSE+IDL+KEKNFF
Sbjct: 345 RDSMPRGVLGMNAAIMEEYLHFICNRRLAQIGLKEQYPGAENPFPWMSEIIDLRKEKNFF 404

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 405 ETRVTEYQVGGALSWD 420


>gi|226940720|ref|YP_002795794.1| ribonucleotide-diphosphate reductase subunit beta [Laribacter
           hongkongensis HLHK9]
 gi|226715647|gb|ACO74785.1| Ribonucleoside-diphosphate reductase beta chain [Laribacter
           hongkongensis HLHK9]
          Length = 357

 Score =  201 bits (511), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 92/136 (67%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN IK ENPHLWT EFQ++   +  +A  LE AYA
Sbjct: 222 MTGAAEQYQYILRDESMHCNFGIDLINSIKQENPHLWTVEFQEELYGLFRKAIDLEYAYA 281

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y+ FIANRR  QIGLEPLF + +NPFPWMSE+IDLKKEKNFF
Sbjct: 282 EDTMPRGVLGLNAAMFKEYLDFIANRRMQQIGLEPLFTHVDNPFPWMSEMIDLKKEKNFF 341

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 342 ETRVTEYQSGGALDWD 357


>gi|88705571|ref|ZP_01103281.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
 gi|88700084|gb|EAQ97193.1| ribonucleoside-diphosphate reductase, beta subunit [Congregibacter
           litoralis KT71]
          Length = 469

 Score =  201 bits (510), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENP LWT+EF+Q++  M+ E T LEI YA
Sbjct: 334 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPQLWTEEFKQEAIQMILEGTQLEIEYA 393

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  QIGL   F   +NPFPWMSE++DL+KEKNFF
Sbjct: 394 RDTMPRGVLGMNAAMMEEYLQFIANRRLSQIGLPEQFPGVQNPFPWMSEIMDLRKEKNFF 453

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 454 ETRVIEYQTGGALSWD 469


>gi|90022104|ref|YP_527931.1| ribonucleotide-diphosphate reductase subunit beta [Saccharophagus
           degradans 2-40]
 gi|89951704|gb|ABD81719.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 423

 Score =  201 bits (510), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT+EFQ +++ M+ E T LEIAYA
Sbjct: 288 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTEEFQAETKQMILEGTELEIAYA 347

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRR  Q+GL   +   +NPFPWMSE++DL+KEKNFF
Sbjct: 348 RDTMPRGVLGMNAAMMEEYLHFIANRRMAQLGLAEAYPGAKNPFPWMSEIMDLRKEKNFF 407

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 408 ETRVIEYQTGGALSWE 423


>gi|325519933|gb|EGC99191.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           TJI49]
          Length = 403

 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|206561765|ref|YP_002232530.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia J2315]
 gi|254246390|ref|ZP_04939711.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|124871166|gb|EAY62882.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           cenocepacia PC184]
 gi|198037807|emb|CAR53751.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           cenocepacia J2315]
          Length = 403

 Score =  200 bits (509), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|163854887|ref|YP_001629185.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella
           petrii DSM 12804]
 gi|163258615|emb|CAP40914.1| ribonucleoside-diphosphate reductase beta chain [Bordetella petrii]
          Length = 396

 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN IK+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 261 MTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWTPEFREEIRGLFQKAVELEYAYA 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+   ENPFPWM+E+IDLKKE+NFF
Sbjct: 321 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFF 380

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 381 ETRVIEYQTGGTLSWE 396


>gi|187479453|ref|YP_787478.1| ribonucleotide-diphosphate reductase subunit beta [Bordetella avium
           197N]
 gi|115424040|emb|CAJ50593.1| ribonucleoside-diphosphate reductase beta chain [Bordetella avium
           197N]
          Length = 394

 Score =  200 bits (508), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN IK+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 259 MTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWTPEFREEIRELFRKAVELEYAYA 318

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+   ENPFPWM+E+IDLKKE+NFF
Sbjct: 319 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFF 378

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 379 ETRVIEYQTGGTLSWE 394


>gi|121598515|ref|YP_991780.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei SAVP1]
 gi|124385654|ref|YP_001027273.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10229]
 gi|126439848|ref|YP_001060484.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 668]
 gi|126451145|ref|YP_001082790.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei NCTC 10247]
 gi|126453692|ref|YP_001067748.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1106a]
 gi|134280207|ref|ZP_01766918.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|166998593|ref|ZP_02264451.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|167721297|ref|ZP_02404533.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei DM98]
 gi|167740266|ref|ZP_02413040.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 14]
 gi|167817486|ref|ZP_02449166.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 91]
 gi|167847373|ref|ZP_02472881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei B7210]
 gi|167895962|ref|ZP_02483364.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 7894]
 gi|167904346|ref|ZP_02491551.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei NCTC 13177]
 gi|167912606|ref|ZP_02499697.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 112]
 gi|217420440|ref|ZP_03451945.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|226196790|ref|ZP_03792369.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813879|ref|YP_002898330.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238561262|ref|ZP_00442338.2| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242316188|ref|ZP_04815204.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|254178822|ref|ZP_04885476.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|254199038|ref|ZP_04905453.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|254202774|ref|ZP_04909137.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|254259655|ref|ZP_04950709.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
 gi|254299327|ref|ZP_04966777.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|121227325|gb|ABM49843.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei SAVP1]
 gi|124293674|gb|ABN02943.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10229]
 gi|126219341|gb|ABN82847.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 668]
 gi|126227334|gb|ABN90874.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106a]
 gi|126244015|gb|ABO07108.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei NCTC 10247]
 gi|134248214|gb|EBA48297.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 305]
 gi|147747021|gb|EDK54098.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei FMH]
 gi|157808756|gb|EDO85926.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 406e]
 gi|160694736|gb|EDP84744.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 10399]
 gi|169656868|gb|EDS88265.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei S13]
 gi|217395852|gb|EEC35869.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 576]
 gi|225931050|gb|EEH27058.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pakistan 9]
 gi|237506031|gb|ACQ98349.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei MSHR346]
 gi|238524965|gb|EEP88395.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei GB8 horse 4]
 gi|242139427|gb|EES25829.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1106b]
 gi|243065276|gb|EES47462.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei PRL-20]
 gi|254218344|gb|EET07728.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1710a]
          Length = 403

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|256822964|ref|YP_003146927.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
 gi|256796503|gb|ACV27159.1| Ribonucleoside-diphosphate reductase [Kangiella koreensis DSM
           16069]
          Length = 421

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFG+D+INQIK+ENPHLWT EF+Q+   M+ E T LEI YA
Sbjct: 286 MTGVAEQFQYILRDESMHLNFGVDIINQIKLENPHLWTAEFKQEVLQMILEGTQLEIEYA 345

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFI NRR  Q+GL   FK   NPFPWMSE++DLKKEKNFF
Sbjct: 346 RDTMPRGVLGMNAGMMEEYLQFICNRRLAQLGLPEQFKNVSNPFPWMSEIMDLKKEKNFF 405

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 406 ETRVIEYQTGGALSWD 421


>gi|254282900|ref|ZP_04957868.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
 gi|219679103|gb|EED35452.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium NOR51-B]
          Length = 421

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT EFQ++   M+ E T LEI YA
Sbjct: 286 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTAEFQEEVVQMILEGTQLEIEYA 345

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFI NRR +Q+GL   +   +NPFPWMSE++DL+KEKNFF
Sbjct: 346 RDTMPRGVLGMNAAMMEEYLQFICNRRLNQLGLSEQYPGVQNPFPWMSEIMDLRKEKNFF 405

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 406 ETRVIEYQTGGALTWD 421


>gi|161525957|ref|YP_001580969.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|160343386|gb|ABX16472.1| Ribonucleoside-diphosphate reductase [Burkholderia multivorans ATCC
           17616]
          Length = 396

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 261 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 321 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 380

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 381 ETRVIEYQTGGALSWE 396


>gi|76808925|ref|YP_334881.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 1710b]
 gi|254208116|ref|ZP_04914466.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
 gi|76578378|gb|ABA47853.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei 1710b]
 gi|147752010|gb|EDK59077.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei JHU]
          Length = 376

 Score =  200 bits (508), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 241 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 300

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 301 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 360

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 361 ETRVIEYQTGGALSWE 376


>gi|330430727|gb|AEC22061.1| ribonucleoside-diphosphate reductase beta chain [Pusillimonas sp.
           T7-7]
          Length = 387

 Score =  200 bits (508), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN IK+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 252 MTGAAEQYMYILRDESMHCNFGIDLINTIKLENPHLWTAEFREELRELFKKAVDLEYAYA 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FIANRRC QIGLEPLF   ENPFPWM+E+IDLKKE+NFF
Sbjct: 312 EDTMPRGVLGLNASMFKSYLRFIANRRCQQIGLEPLFGQEENPFPWMAEMIDLKKERNFF 371

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 372 ETRVIEYQTGGALSWE 387


>gi|189349324|ref|YP_001944952.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           multivorans ATCC 17616]
 gi|221213238|ref|ZP_03586213.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
 gi|189333346|dbj|BAG42416.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           multivorans ATCC 17616]
 gi|221166690|gb|EED99161.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD1]
          Length = 403

 Score =  200 bits (508), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|83719302|ref|YP_441701.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
 gi|83653127|gb|ABC37190.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           thailandensis E264]
          Length = 377

 Score =  200 bits (508), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 242 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 302 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 361

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 362 ETRVIEYQTGGALSWE 377


>gi|119504228|ref|ZP_01626308.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
 gi|119459736|gb|EAW40831.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2080]
          Length = 419

 Score =  199 bits (507), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENP LWT EFQQ++  M+ E T LEIAYA
Sbjct: 284 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPLLWTPEFQQEAIQMILEGTELEIAYA 343

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFI NRR +Q+GL   F   +NPFPWMSE++DL+KEKNFF
Sbjct: 344 RDTMPRGVLGMNAAMMEEYLQFICNRRLNQVGLPEQFPGAQNPFPWMSEIMDLRKEKNFF 403

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 404 ETRVIEYQTGGALTWD 419


>gi|167574685|ref|ZP_02367559.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis C6786]
          Length = 369

 Score =  199 bits (507), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 234 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 293

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 294 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 353

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 354 ETRVIEYQTGGALSWE 369


>gi|167564160|ref|ZP_02357076.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           oklahomensis EO147]
          Length = 369

 Score =  199 bits (507), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 234 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 293

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 294 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 353

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 354 ETRVIEYQTGGALSWE 369


>gi|73542624|ref|YP_297144.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha JMP134]
 gi|72120037|gb|AAZ62300.1| Ribonucleoside-diphosphate reductase [Ralstonia eutropha JMP134]
          Length = 394

 Score =  199 bits (507), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 259 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 318

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 319 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFF 378

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 379 ETRVIEYQTGGALSWD 394


>gi|167825888|ref|ZP_02457359.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei 9]
 gi|167924622|ref|ZP_02511713.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei BCC215]
 gi|254180586|ref|ZP_04887184.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
 gi|254190977|ref|ZP_04897483.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157938651|gb|EDO94321.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei Pasteur 52237]
 gi|184211125|gb|EDU08168.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           pseudomallei 1655]
          Length = 372

 Score =  199 bits (507), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 237 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 296

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 297 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 356

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 357 ETRVIEYQTGGALSWE 372


>gi|194290770|ref|YP_002006677.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           taiwanensis LMG 19424]
 gi|193224605|emb|CAQ70616.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Cupriavidus taiwanensis LMG 19424]
          Length = 396

 Score =  199 bits (507), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 261 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 321 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFF 380

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 381 ETRVIEYQTGGALSWD 396


>gi|317402620|gb|EFV83180.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans C54]
          Length = 399

 Score =  199 bits (507), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN +K+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 264 MTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLWTPEFREEIRELFRKAVELEYAYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+   ENPFPWM+E+IDLKKE+NFF
Sbjct: 324 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFF 383

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 384 ETRVIEYQTGGTLSWE 399


>gi|311103857|ref|YP_003976710.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
 gi|310758546|gb|ADP13995.1| ribonucleoside-diphosphate reductase subunit beta [Achromobacter
           xylosoxidans A8]
          Length = 399

 Score =  199 bits (506), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN +K+ENPHLWT EF+++ R +  +A  LE AYA
Sbjct: 264 MTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLWTPEFREEIRELFRKAVELEYAYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+   ENPFPWM+E+IDLKKE+NFF
Sbjct: 324 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFF 383

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 384 ETRVIEYQTGGTLSWE 399


>gi|170699976|ref|ZP_02891003.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
 gi|170135124|gb|EDT03425.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           IOP40-10]
          Length = 403

 Score =  199 bits (506), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|254253304|ref|ZP_04946622.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
 gi|124895913|gb|EAY69793.1| ribonucleotide-diphosphate reductase beta subunit [Burkholderia
           dolosa AUO158]
          Length = 403

 Score =  199 bits (506), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|221202418|ref|ZP_03575450.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
 gi|221208122|ref|ZP_03581127.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221172025|gb|EEE04467.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2]
 gi|221177695|gb|EEE10110.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           multivorans CGD2M]
          Length = 372

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 237 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 296

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 297 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 356

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 357 ETRVIEYQTGGALSWE 372


>gi|113869188|ref|YP_727677.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           eutropha H16]
 gi|113527964|emb|CAJ94309.1| Ribonucleoside-diphosphate reductase beta subunit [Ralstonia
           eutropha H16]
          Length = 395

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 260 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 319

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 320 EDTMPRGVLGLNAPMFKSYLRFICNRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFF 379

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 380 ETRVIEYQTGGALSWD 395


>gi|78065156|ref|YP_367925.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia sp.
           383]
 gi|77965901|gb|ABB07281.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. 383]
          Length = 403

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|115350552|ref|YP_772391.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria AMMD]
 gi|172059584|ref|YP_001807236.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ambifaria MC40-6]
 gi|115280540|gb|ABI86057.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria AMMD]
 gi|171992101|gb|ACB63020.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria
           MC40-6]
          Length = 403

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|171318520|ref|ZP_02907672.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
 gi|171096306|gb|EDT41212.1| Ribonucleoside-diphosphate reductase [Burkholderia ambifaria MEX-5]
          Length = 403

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|170731918|ref|YP_001763865.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia MC0-3]
 gi|169815160|gb|ACA89743.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           MC0-3]
          Length = 403

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|209521089|ref|ZP_03269819.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
 gi|209498472|gb|EDZ98597.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. H160]
          Length = 411

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 276 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRAIFQQAVELEYRYA 335

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 336 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 395

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 396 ETRVIEYQTGGALSWE 411


>gi|295677726|ref|YP_003606250.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
 gi|295437569|gb|ADG16739.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1002]
          Length = 411

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 276 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRAIFQQAVELEYRYA 335

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 336 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 395

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 396 ETRVIEYQTGGALSWE 411


>gi|53720599|ref|YP_109585.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           pseudomallei K96243]
 gi|53726102|ref|YP_104055.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           mallei ATCC 23344]
 gi|52211013|emb|CAH37001.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           pseudomallei K96243]
 gi|52429525|gb|AAU50118.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           mallei ATCC 23344]
          Length = 350

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 215 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 274

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 275 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 334

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 335 ETRVIEYQTGGALSWE 350


>gi|167580513|ref|ZP_02373387.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis TXDOH]
 gi|167618621|ref|ZP_02387252.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis Bt4]
 gi|257137870|ref|ZP_05586132.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis E264]
          Length = 350

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 215 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 274

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 275 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 334

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 335 ETRVIEYQTGGALSWE 350


>gi|302877617|ref|YP_003846181.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
 gi|302580406|gb|ADL54417.1| Ribonucleoside-diphosphate reductase [Gallionella capsiferriformans
           ES-2]
          Length = 365

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+HLNFG+D+INQIK+ENPHLWT  F+++ R ++ +   LE AYA
Sbjct: 230 MTGAAEQYQYILRDESMHLNFGVDLINQIKMENPHLWTAAFREEIRGLMQKGVELEYAYA 289

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRRC QIG++ L++   NPFPWMSE+IDLKKEKNFF
Sbjct: 290 EDTMPRGILGLNATMFKEYLRFIANRRCQQIGVDILYQGATNPFPWMSEMIDLKKEKNFF 349

Query: 121 ETRVTEYQQGAGLKWD 136
           E+RVTEYQ G  L WD
Sbjct: 350 ESRVTEYQTGGTLSWD 365


>gi|291615085|ref|YP_003525242.1| ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585197|gb|ADE12855.1| Ribonucleoside-diphosphate reductase [Sideroxydans lithotrophicus
           ES-1]
          Length = 382

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+HLNFG+DVINQIK+ENPHLWT  F+++ R ++ +   LE  YA
Sbjct: 247 MTGAAEQYQYILRDESMHLNFGVDVINQIKLENPHLWTPAFREEVRGLIQKGVELEYRYA 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRRC QIG++ L++   NPFPWM+E+IDLKKEKNFF
Sbjct: 307 EDTMPRGVLGLNAGMFKEYLRFIANRRCQQIGVDMLYQGATNPFPWMAEMIDLKKEKNFF 366

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 367 ETRVTEYQTGGALSWD 382


>gi|167837963|ref|ZP_02464822.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           thailandensis MSMB43]
          Length = 303

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 168 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVDLEYRYA 227

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 228 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLFPNEENPFPWMSEMIDLKKERNFF 287

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 288 ETRVIEYQTGGALSWE 303


>gi|238026167|ref|YP_002910398.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           glumae BGR1]
 gi|237875361|gb|ACR27694.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           glumae BGR1]
          Length = 407

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 272 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIRELFKRAVELEYRYA 331

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FIANRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 332 EDTMPRGVLGLNAAMFKSYLRFIANRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 391

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 392 ETRVIEYQTGGALSWE 407


>gi|107021673|ref|YP_620000.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia AU 1054]
 gi|116688619|ref|YP_834242.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           cenocepacia HI2424]
 gi|105891862|gb|ABF75027.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia AU
           1054]
 gi|116646708|gb|ABK07349.1| Ribonucleoside-diphosphate reductase [Burkholderia cenocepacia
           HI2424]
          Length = 382

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 247 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVELEYRYA 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 307 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 366

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 367 ETRVIEYQTGGALSWE 382


>gi|254784923|ref|YP_003072351.1| ribonucleotide-diphosphate reductase subunit beta [Teredinibacter
           turnerae T7901]
 gi|237687536|gb|ACR14800.1| ribonucleoside-diphosphate reductase [Teredinibacter turnerae
           T7901]
          Length = 453

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 109/135 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT+ FQQ+ + M+ E T LEI YA
Sbjct: 319 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTESFQQEVKQMVLEGTELEIGYA 378

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRR  Q+GL+  +   +NPFPWMSE++DL+KEKNFF
Sbjct: 379 RDTMPRGVLGMNAAIMEEYLHFIANRRLAQLGLKEAYPGAQNPFPWMSEIMDLRKEKNFF 438

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ G  L W
Sbjct: 439 ETRVIEYQTGGALSW 453


>gi|94312018|ref|YP_585228.1| ribonucleotide-diphosphate reductase subunit beta [Cupriavidus
           metallidurans CH34]
 gi|93355870|gb|ABF09959.1| Ribonucleoside-diphosphate reductase beta subunit [Cupriavidus
           metallidurans CH34]
          Length = 395

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 260 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 319

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 320 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDQLFPNEENPFPWMSEMIDLKKERNFF 379

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 380 ETRVIEYQTGGALSWD 395


>gi|325983070|ref|YP_004295472.1| ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
 gi|325532589|gb|ADZ27310.1| Ribonucleoside-diphosphate reductase [Nitrosomonas sp. AL212]
          Length = 381

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDVINQIK+ENP LWTK F+++   ++ +A  LE  YA
Sbjct: 246 MTGSAEQYQYILRDESMHCNFGIDVINQIKMENPQLWTKAFREEIAALMQKAVALEYRYA 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NAP  ++Y+++IANRRC QIGL+ L+    NPFPWMSE++DLKKEKNFF
Sbjct: 306 EDTMPRGVLGMNAPMFKEYLRYIANRRCQQIGLDTLYPNANNPFPWMSEMMDLKKEKNFF 365

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 366 ETRVTEYQTGGALSWD 381


>gi|260220050|emb|CBA27200.1| Ribonucleoside-diphosphate reductase subunit alpha [Curvibacter
            putative symbiont of Hydra magnipapillata]
          Length = 1306

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1    MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
            M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+ + + +  +A  LE  YA
Sbjct: 1171 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTPEFKAEIKALFEKAVELEYRYA 1230

Query: 61   HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
             +TMP+G +G+NA   + Y+++IANRR  QIGLEPLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 1231 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEPLFPNEENPFPWMSEMIDLKKERNFF 1290

Query: 121  ETRVTEYQQGAGLKWD 136
            ETRV EYQ G  L WD
Sbjct: 1291 ETRVIEYQSGGALSWD 1306


>gi|329893650|ref|ZP_08269784.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
 gi|328923577|gb|EGG30889.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC3088]
          Length = 432

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT++FQ++   ML E T +EI YA
Sbjct: 297 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTEDFQKEVIQMLLEGTQIEIEYA 356

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFI NRR  Q+GL   F   +NPFPWMSE++DL+KEKNFF
Sbjct: 357 RDTMPRGVLGMNAAMMEEYLQFICNRRLAQLGLPEQFPGVQNPFPWMSEIMDLRKEKNFF 416

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 417 ETRVIEYQTGGALSWD 432


>gi|134294683|ref|YP_001118418.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           vietnamiensis G4]
 gi|134137840|gb|ABO53583.1| Ribonucleoside-diphosphate reductase [Burkholderia vietnamiensis
           G4]
          Length = 403

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKHAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI+NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFISNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|17547523|ref|NP_520925.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           solanacearum GMI1000]
 gi|17429827|emb|CAD16511.1| putative transmembrane ribonucleoside reductase (small chain)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 400

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 265 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   +NPFPWMSE+IDLKKE+NFF
Sbjct: 325 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEDNPFPWMSEMIDLKKERNFF 384

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 385 ETRVIEYQTGGALSWD 400


>gi|167586060|ref|ZP_02378448.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           ubonensis Bu]
          Length = 403

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTAEFRAEIRELFKQAVDLEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 388 ETRVIEYQTGGALSWE 403


>gi|152980709|ref|YP_001354668.1| ribonucleotide-diphosphate reductase subunit beta
           [Janthinobacterium sp. Marseille]
 gi|151280786|gb|ABR89196.1| ribonucleoside-diphosphate reductase beta chain [Janthinobacterium
           sp. Marseille]
          Length = 392

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT +F+++ +T+   A  LE  YA
Sbjct: 257 MMGAAEQYQYILRDESMHCNFGIDLINTIKLENPHLWTPQFREEIKTLFLRAVELEYRYA 316

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+F+  ENPFPWMSE+IDLKKE+NFF
Sbjct: 317 EDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPMFEQEENPFPWMSEMIDLKKERNFF 376

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 377 ETRVIEYQTGGALNWE 392


>gi|299065648|emb|CBJ36820.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum CMR15]
          Length = 398

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 263 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 322

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   +NPFPWMSE+IDLKKE+NFF
Sbjct: 323 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEDNPFPWMSEMIDLKKERNFF 382

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 383 ETRVIEYQTGGALSWD 398


>gi|28868867|ref|NP_791486.1| ribonucleoside-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213969520|ref|ZP_03397656.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|301385974|ref|ZP_07234392.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058701|ref|ZP_07250242.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato K40]
 gi|302134408|ref|ZP_07260398.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|28852106|gb|AAO55181.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|213925616|gb|EEB59175.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. tomato T1]
 gi|330960626|gb|EGH60886.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. maculicola str. ES4326]
 gi|331016758|gb|EGH96814.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|320323423|gb|EFW79511.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320327620|gb|EFW83632.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330876273|gb|EGH10422.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|71737432|ref|YP_275887.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257485935|ref|ZP_05639976.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289628680|ref|ZP_06461634.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289648392|ref|ZP_06479735.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|298487941|ref|ZP_07005980.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302184861|ref|ZP_07261534.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae 642]
 gi|71557985|gb|AAZ37196.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298157492|gb|EFH98573.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|330866023|gb|EGH00732.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330896997|gb|EGH28545.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330986742|gb|EGH84845.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. lachrymans str. M301315]
 gi|331010341|gb|EGH90397.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|70731866|ref|YP_261608.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf-5]
 gi|68346165|gb|AAY93771.1| ribonucleoside-diphosphate reductase, beta subunit, putative
           [Pseudomonas fluorescens Pf-5]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|330880140|gb|EGH14289.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330966559|gb|EGH66819.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|66046950|ref|YP_236791.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae B728a]
 gi|237798938|ref|ZP_04587399.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|237806191|ref|ZP_04592895.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|63257657|gb|AAY38753.1| Ribonucleoside-diphosphate reductase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330980156|gb|EGH78342.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. aptata str. DSM 50252]
 gi|331021792|gb|EGI01849.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331027304|gb|EGI07359.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 415

 Score =  198 bits (503), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|330811278|ref|YP_004355740.1| Ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379386|gb|AEA70736.1| Ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 415

 Score =  198 bits (503), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|77460516|ref|YP_350023.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens Pf0-1]
 gi|77384519|gb|ABA76032.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens Pf0-1]
          Length = 416

 Score =  198 bits (503), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEASQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|312960686|ref|ZP_07775192.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
 gi|311285212|gb|EFQ63787.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
          Length = 416

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|330892405|gb|EGH25066.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. mori str. 301020]
          Length = 415

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|229590245|ref|YP_002872364.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229362111|emb|CAY49013.1| putative ribonucleoside-diphosphate reductase beta chain
           [Pseudomonas fluorescens SBW25]
          Length = 416

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|229592166|ref|YP_002874285.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           fluorescens SBW25]
 gi|229364032|emb|CAY51597.1| ribonucleoside-diphosphate reductase beta chain [Pseudomonas
           fluorescens SBW25]
          Length = 416

 Score =  197 bits (502), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|293603286|ref|ZP_06685715.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
 gi|292818321|gb|EFF77373.1| ribonucleotide-diphosphate reductase subunit beta subunit
           [Achromobacter piechaudii ATCC 43553]
          Length = 398

 Score =  197 bits (501), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQY YI+RDES+H NFGID+IN +K+ENPHLWT  F+++ R +  +A  LE AYA
Sbjct: 263 MTGAAEQYMYILRDESMHCNFGIDLINTVKLENPHLWTPAFREEIRELFRKAVELEYAYA 322

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRRC QIG+EPL+   ENPFPWM+E+IDLKKE+NFF
Sbjct: 323 EDTMPRGVLGLNAPMFKSYLRFIANRRCQQIGIEPLYPQEENPFPWMAEMIDLKKERNFF 382

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 383 ETRVIEYQTGGTLSWE 398


>gi|312962626|ref|ZP_07777115.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
 gi|311283001|gb|EFQ61593.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           fluorescens WH6]
          Length = 136

 Score =  197 bits (501), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 1   MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 60

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 61  RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 120

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 121 ETRVIEYQTGGALSWD 136


>gi|300309722|ref|YP_003773814.1| transmembrane ribonucleoside reductase small subunit
           [Herbaspirillum seropedicae SmR1]
 gi|300072507|gb|ADJ61906.1| transmembrane ribonucleoside reductase (small chain) protein
           [Herbaspirillum seropedicae SmR1]
          Length = 388

 Score =  197 bits (501), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 109/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G AEQYQYI+RDES+H NFGID+IN +K+ENPHLWT EF+++ +++   A  LE  YA
Sbjct: 253 MMGAAEQYQYILRDESMHCNFGIDLINTVKMENPHLWTPEFREEIKSLFLRAVELEYRYA 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRR  QIGL+PLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 313 EDTMPRGVLGLNAPMFKSYLRFIANRRAQQIGLDPLFAQEENPFPWMSEMIDLKKERNFF 372

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 373 ETRVIEYQTGGALSWE 388


>gi|187930114|ref|YP_001900601.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12J]
 gi|187727004|gb|ACD28169.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12J]
          Length = 402

 Score =  197 bits (500), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 387 ETRVIEYQTGGALSWE 402


>gi|241664219|ref|YP_002982579.1| ribonucleotide-diphosphate reductase subunit beta [Ralstonia
           pickettii 12D]
 gi|309783064|ref|ZP_07677783.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
 gi|240866246|gb|ACS63907.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|308918172|gb|EFP63850.1| ribonucleoside-diphosphate reductase, beta subunit [Ralstonia sp.
           5_7_47FAA]
          Length = 402

 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 387 ETRVIEYQTGGALSWE 402


>gi|329902475|ref|ZP_08273120.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548767|gb|EGF33404.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 416

 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG AEQYQYI+RDES+H NFGID++N IK+ENPHLWT EF+ + + +   A  LE  YA
Sbjct: 281 MVGAAEQYQYILRDESMHCNFGIDLVNTIKMENPHLWTPEFRDEIKALFLTAVELEYRYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+F+  ENPFPWMSE+IDLKKE+NFF
Sbjct: 341 EDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPMFENEENPFPWMSEMIDLKKERNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 401 ETRVIEYQTGGALSWE 416


>gi|300690381|ref|YP_003751376.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
 gi|299077441|emb|CBJ50067.1| ribonucleoside diphosphate reductase 1, beta subunit, ferritin-like
           [Ralstonia solanacearum PSI07]
          Length = 402

 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKAEITELFKKAVDLEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FI NRRC QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNAPMFKGYLRFICNRRCQQIGLDALFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 387 ETRVIEYQTGGALSWE 402


>gi|297538242|ref|YP_003674011.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
 gi|297257589|gb|ADI29434.1| Ribonucleoside-diphosphate reductase [Methylotenera sp. 301]
          Length = 376

 Score =  197 bits (500), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDVIN IK+ENPHLWT EF+++ +T++ +   LE  YA
Sbjct: 241 MQGAAEQYQYILRDESMHCNFGIDVINTIKLENPHLWTAEFREEIKTLMQKGVELEYQYA 300

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
             TMP+G +GLNA   ++Y++FIANRRC QIGL+ L+    NPFPWMSE++DLKKEKNFF
Sbjct: 301 EATMPRGVLGLNATMFKEYLRFIANRRCTQIGLDVLYPGATNPFPWMSEMMDLKKEKNFF 360

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 361 ETRVTEYQTGGALSWD 376


>gi|331006663|ref|ZP_08329944.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
 gi|330419531|gb|EGG93916.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit [gamma
           proteobacterium IMCC1989]
          Length = 444

 Score =  196 bits (499), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIK+ENPHLWT+EF+ +   M+ E T LEIAYA
Sbjct: 309 MTGVAEQFQYILRDESMHLNFGIDIINQIKLENPHLWTEEFKAEVTQMVLEGTELEIAYA 368

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFI+NRR  Q+GL   +   +NPFPWMSE++DL+KEKNFF
Sbjct: 369 RDTMPRGVLGMNAAMMEEYLQFISNRRLAQLGLTEQYPGAQNPFPWMSEIMDLRKEKNFF 428

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 429 ETRVIEYQTGGALTWE 444


>gi|289677030|ref|ZP_06497920.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. syringae FF5]
          Length = 243

 Score =  196 bits (498), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 108 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKEEATQMILQGTQLEIEYA 167

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 168 RDTMPRGVLGMNAAMMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 227

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 228 ETRVIEYQTGGALSWD 243


>gi|253997287|ref|YP_003049351.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
 gi|253983966|gb|ACT48824.1| Ribonucleoside-diphosphate reductase [Methylotenera mobilis JLW8]
          Length = 377

 Score =  196 bits (498), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGIDVIN IK+ENPHLWT EF+ + + ++     LE  YA
Sbjct: 242 MQGAAEQYQYILRDESMHCNFGIDVINTIKLENPHLWTAEFRDEIKGLIQHGVELEYRYA 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
             TMP+G +GLNA   ++Y++FIANRRC QIGL+ L++   NPFPWMSE+IDLKKEKNFF
Sbjct: 302 EATMPRGVLGLNATMFKEYLRFIANRRCQQIGLDVLYQGATNPFPWMSEMIDLKKEKNFF 361

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 362 ETRVTEYQTGGALSWD 377


>gi|296160506|ref|ZP_06843322.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
 gi|295889255|gb|EFG69057.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. Ch1-1]
          Length = 415

 Score =  196 bits (498), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 280 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 340 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 400 ETRVIEYQTGGALTWE 415


>gi|187925407|ref|YP_001897049.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phytofirmans PsJN]
 gi|187716601|gb|ACD17825.1| Ribonucleoside-diphosphate reductase [Burkholderia phytofirmans
           PsJN]
          Length = 415

 Score =  196 bits (498), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 280 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 340 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 400 ETRVIEYQTGGALTWE 415


>gi|74317993|ref|YP_315733.1| ribonucleotide-diphosphate reductase subunit beta [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057488|gb|AAZ97928.1| ribonucleoside-diphosphate reductase beta chain [Thiobacillus
           denitrificans ATCC 25259]
          Length = 376

 Score =  196 bits (498), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN IK ENPHLWT EF+ + RT++ +   LE  YA
Sbjct: 241 MTGAAEQYQYILRDESMHCNFGIDLINTIKQENPHLWTSEFKAEIRTLIQKGVELEFRYA 300

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLN+   ++Y++FI+NRRC QIGL+ +F    NPFPWM+E+IDLKKEKNFF
Sbjct: 301 EDTMPRGVLGLNSAQFKEYLRFISNRRCQQIGLDEMFPGVSNPFPWMAEMIDLKKEKNFF 360

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 361 ETRVTEYQTGGALSWD 376


>gi|186477386|ref|YP_001858856.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           phymatum STM815]
 gi|184193845|gb|ACC71810.1| Ribonucleoside-diphosphate reductase [Burkholderia phymatum STM815]
          Length = 407

 Score =  196 bits (498), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 272 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIREIFKHAVDLEYRYA 331

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIG++PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 332 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGIDPLYPNEENPFPWMSEMIDLKKERNFF 391

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 392 ETRVIEYQTGGALSWE 407


>gi|330815478|ref|YP_004359183.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
 gi|327367871|gb|AEA59227.1| Ribonucleoside-diphosphate reductase, beta subunit [Burkholderia
           gladioli BSR3]
          Length = 407

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT EF+ + R +   A  LE  YA
Sbjct: 272 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPEFRAEIRELFKHAVELEYRYA 331

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FIANRRC QIGL+ L+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 332 EDTMPRGVLGLNASMFKSYLRFIANRRCQQIGLDALYPNEENPFPWMSEMIDLKKERNFF 391

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 392 ETRVIEYQTGGALSWE 407


>gi|110833571|ref|YP_692430.1| ribonucleotide-diphosphate reductase subunit beta [Alcanivorax
           borkumensis SK2]
 gi|110646682|emb|CAL16158.1| ribonucleoside reductase, beta subunit [Alcanivorax borkumensis
           SK2]
          Length = 430

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+H+NFGIDVINQIK+ENPHLW  + + K+  M+ E T LEI YA
Sbjct: 295 MTGVAEQFQYILRDESMHVNFGIDVINQIKLENPHLWDAQMRDKATQMILEGTELEIQYA 354

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  Q+GL   FK   NPFPWMSE++DL+KEKNFF
Sbjct: 355 RDTMPRGVLGMNAAMMEEYLQFIANRRLAQLGLPEQFKGVNNPFPWMSEIMDLRKEKNFF 414

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L W+
Sbjct: 415 ETRVTEYQVGGALSWE 430


>gi|170695324|ref|ZP_02886470.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
 gi|170139724|gb|EDT07906.1| Ribonucleoside-diphosphate reductase [Burkholderia graminis C4D1M]
          Length = 414

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 279 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 338

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 339 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 398

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 399 ETRVIEYQTGGALTWE 414


>gi|307731037|ref|YP_003908261.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
 gi|307585572|gb|ADN58970.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1003]
          Length = 411

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 276 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 335

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 336 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 395

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 396 ETRVIEYQTGGALTWE 411


>gi|91785256|ref|YP_560462.1| ribonucleotide-diphosphate reductase subunit beta [Burkholderia
           xenovorans LB400]
 gi|91689210|gb|ABE32410.1| Ribonucleoside-diphosphate reductase [Burkholderia xenovorans
           LB400]
          Length = 411

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 276 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 335

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 336 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 395

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 396 ETRVIEYQTGGALTWE 411


>gi|134095932|ref|YP_001101007.1| ribonucleotide-diphosphate reductase subunit beta [Herminiimonas
           arsenicoxydans]
 gi|133739835|emb|CAL62886.1| Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide
           reductase small subunit) [Herminiimonas arsenicoxydans]
          Length = 395

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT +F+ + + +   A  LE  YA
Sbjct: 260 MMGAAEQYQYILRDESMHCNFGIDLINTIKLENPHLWTPQFRDEIKALFLRAVELEYRYA 319

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y++FIANRR  QIGLEP+F+  ENPFPWMSE+IDLKKE+NFF
Sbjct: 320 EDTMPRGVLGLNAPMFKGYLRFIANRRAQQIGLEPMFEQEENPFPWMSEMIDLKKERNFF 379

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 380 ETRVIEYQTGGALNWE 395


>gi|148546452|ref|YP_001266554.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida F1]
 gi|148510510|gb|ABQ77370.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida F1]
          Length = 415

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW    ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|254483523|ref|ZP_05096750.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
 gi|214036244|gb|EEB76924.1| ribonucleoside-diphosphate reductase, beta subunit [marine gamma
           proteobacterium HTCC2148]
          Length = 425

 Score =  195 bits (496), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENP+LWT+ FQQ+   M+ E T +EI YA
Sbjct: 290 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPNLWTETFQQEVIQMILEGTEIEIQYA 349

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRR  Q+GL   F   +NPFPWMSE++DL+KEKNFF
Sbjct: 350 RDTMPRGVLGMNAAIMEEYLHFIANRRLSQLGLPEQFAGAQNPFPWMSEIMDLRKEKNFF 409

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 410 ETRVIEYQTGGALSWD 425


>gi|323527395|ref|YP_004229548.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
 gi|323384397|gb|ADX56488.1| Ribonucleoside-diphosphate reductase [Burkholderia sp. CCGE1001]
          Length = 414

 Score =  195 bits (496), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 279 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFRAEIREIFQQAVELEYRYA 338

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGL+PL+   ENPFPWMSE+IDLKKE+NFF
Sbjct: 339 EDTMPRGVLGLNASMFKSYLRFICNRRCQQIGLDPLYPNEENPFPWMSEMIDLKKERNFF 398

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 399 ETRVIEYQTGGALTWE 414


>gi|325272776|ref|ZP_08139120.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
 gi|324102083|gb|EGB99585.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas sp.
           TJI-51]
          Length = 416

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW    ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|104780527|ref|YP_607025.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           entomophila L48]
 gi|95109514|emb|CAK14215.1| ribonucleoside-diphosphate reductase, beta subunit [Pseudomonas
           entomophila L48]
          Length = 415

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW    ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|170720377|ref|YP_001748065.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida W619]
 gi|169758380|gb|ACA71696.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida W619]
          Length = 416

 Score =  195 bits (496), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW    ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|26987912|ref|NP_743337.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida KT2440]
 gi|167035231|ref|YP_001670462.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           putida GB-1]
 gi|24982621|gb|AAN66801.1|AE016309_3 ribonucleoside reductase, beta subunit [Pseudomonas putida KT2440]
 gi|166861719|gb|ABZ00127.1| Ribonucleoside-diphosphate reductase [Pseudomonas putida GB-1]
 gi|313497534|gb|ADR58900.1| NrdB [Pseudomonas putida BIRD-1]
          Length = 416

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW    ++++  M+ + T LEI YA
Sbjct: 281 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|312795100|ref|YP_004028022.1| ribonucleoside-diphosphate reductase beta chain [Burkholderia
           rhizoxinica HKI 454]
 gi|312166875|emb|CBW73878.1| Ribonucleoside-diphosphate reductase beta chain (EC 1.17.4.1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 416

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENPHLWT  F+++   +   A  LE  YA
Sbjct: 281 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPHLWTPAFREEICGLFKHAVELEYRYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FI NRRC QIGLEPLF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 341 EDTMPRGVLGLNAGMFKSYLRFICNRRCQQIGLEPLFPNEENPFPWMSEMIDLKKERNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 401 ETRVIEYQTGGALSWE 416


>gi|254429337|ref|ZP_05043044.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
 gi|196195506|gb|EDX90465.1| ribonucleoside-diphosphate reductase, beta subunit [Alcanivorax sp.
           DG881]
          Length = 355

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+H+NFGIDVINQIK+ENPHLW  + + K+  M+ E   LEI YA
Sbjct: 220 MTGVAEQFQYILRDESMHVNFGIDVINQIKLENPHLWDAQMRDKATQMILEGAELEIQYA 279

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  Q+GL   FK   NPFPWMSE++DL+KEKNFF
Sbjct: 280 RDTMPRGVLGMNAAMMEEYLQFIANRRLAQLGLPEQFKGVNNPFPWMSEIMDLRKEKNFF 339

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L W+
Sbjct: 340 ETRVTEYQVGGALSWE 355


>gi|119713586|gb|ABL97637.1| ribonucleotide-diphosphate reductase beta subunit [uncultured
           marine bacterium EB0_39H12]
          Length = 412

 Score =  194 bits (493), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGID+INQIK+ENPHLW ++ + ++  M+ E T LEI YA
Sbjct: 277 MTGTAEQFQYILRDESMHLNFGIDMINQIKLENPHLWDEQMRHEAAQMILEGTELEIQYA 336

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+QFIANRR  QIGLE  F+   NPFPWMSE++DL+KEKNFF
Sbjct: 337 RDTMPRGILGMNAGMMEEYLQFIANRRLVQIGLEEEFEGASNPFPWMSEIMDLRKEKNFF 396

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 397 ETRVIEYQTGGALTWD 412


>gi|327480258|gb|AEA83568.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri DSM 4166]
          Length = 415

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGID+INQIKIENPHLW  E + ++  M+ + T LEI YA
Sbjct: 280 MTGTAEQFQYILRDESMHLNFGIDMINQIKIENPHLWNAEMKDEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|262373382|ref|ZP_06066661.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
 gi|262313407|gb|EEY94492.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           junii SH205]
          Length = 427

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|330504346|ref|YP_004381215.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
 gi|328918632|gb|AEB59463.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina NK-01]
          Length = 416

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  + + ++  M+ + T LEI YA
Sbjct: 281 MTGTAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|146308172|ref|YP_001188637.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           mendocina ymp]
 gi|145576373|gb|ABP85905.1| Ribonucleoside-diphosphate reductase [Pseudomonas mendocina ymp]
          Length = 416

 Score =  194 bits (492), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  + + ++  M+ + T LEI YA
Sbjct: 281 MTGTAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|15596352|ref|NP_249846.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAO1]
 gi|107100605|ref|ZP_01364523.1| hypothetical protein PaerPA_01001630 [Pseudomonas aeruginosa PACS2]
 gi|116049087|ref|YP_792111.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152988648|ref|YP_001349579.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PA7]
 gi|218892881|ref|YP_002441750.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa LESB58]
 gi|254239525|ref|ZP_04932847.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|296390475|ref|ZP_06879950.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           aeruginosa PAb1]
 gi|313106126|ref|ZP_07792381.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
 gi|9947077|gb|AAG04544.1|AE004545_7 NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa PAO1]
 gi|115584308|gb|ABJ10323.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126192903|gb|EAZ56966.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa 2192]
 gi|150963806|gb|ABR85831.1| ribonucleoside reductase, small chain [Pseudomonas aeruginosa PA7]
 gi|187939552|gb|ACD38699.1| ribonucleoside reductase small chain [Pseudomonas aeruginosa]
 gi|218773109|emb|CAW28921.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa LESB58]
 gi|310878883|gb|EFQ37477.1| NrdB, tyrosyl radical-harboring component of class Ia
           ribonucleotide reductase [Pseudomonas aeruginosa 39016]
          Length = 415

 Score =  194 bits (492), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  + + ++  M+ + T LEI YA
Sbjct: 280 MTGTAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAQMKDEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|293609145|ref|ZP_06691448.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
 gi|292829718|gb|EFF88080.1| ribonucleoside-diphosphate reductase [Acinetobacter sp. SH024]
          Length = 427

 Score =  194 bits (492), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVVQMIVEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|146282010|ref|YP_001172163.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           stutzeri A1501]
 gi|145570215|gb|ABP79321.1| ribonucleoside reductase, small chain [Pseudomonas stutzeri A1501]
          Length = 415

 Score =  193 bits (491), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGID+INQIKIENPHLW  E + ++  M+ + T LEI YA
Sbjct: 280 MTGTAEQFQYILRDESMHLNFGIDMINQIKIENPHLWDAEMKDEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFF
Sbjct: 340 RDTMPRGVLGMNASMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFF 399

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 400 ETRVIEYQTGGALSWD 415


>gi|260551040|ref|ZP_05825245.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
 gi|260405988|gb|EEW99475.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           sp. RUH2624]
          Length = 427

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|169797064|ref|YP_001714857.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AYE]
 gi|213156529|ref|YP_002318190.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|215484526|ref|YP_002326761.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|239501302|ref|ZP_04660612.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB900]
 gi|260555643|ref|ZP_05827863.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
 gi|294839369|ref|ZP_06784052.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. 6013113]
 gi|294859388|ref|ZP_06797157.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. 6013150]
 gi|301345633|ref|ZP_07226374.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB056]
 gi|301512780|ref|ZP_07238017.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB058]
 gi|301596291|ref|ZP_07241299.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB059]
 gi|169149991|emb|CAM87885.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AYE]
 gi|193076530|gb|ABO11186.2| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           baumannii ATCC 17978]
 gi|213055689|gb|ACJ40591.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii AB0057]
 gi|213987168|gb|ACJ57467.1| ribonucleotide-diphosphate reductase small chain [Acinetobacter
           baumannii AB307-0294]
 gi|260410554|gb|EEX03852.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii ATCC 19606]
          Length = 427

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|184157022|ref|YP_001845361.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ACICU]
 gi|183208616|gb|ACC56014.1| Ribonucleotide reductase, beta subunit [Acinetobacter baumannii
           ACICU]
          Length = 427

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|169634186|ref|YP_001707922.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii SDF]
 gi|169152978|emb|CAP02026.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           baumannii]
          Length = 427

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|255318309|ref|ZP_05359544.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262379054|ref|ZP_06072210.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
 gi|255304621|gb|EET83803.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SK82]
 gi|262298511|gb|EEY86424.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           radioresistens SH164]
          Length = 427

 Score =  193 bits (491), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 108/135 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEIIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR +Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNAAMMEEYLKFICNRRLNQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|325121074|gb|ADY80597.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 370

 Score =  193 bits (490), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 236 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVVQMIVEGTMLEIEYA 295

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 296 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 355

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 356 ETRVTDYQTGGALSW 370


>gi|294339031|emb|CAZ87378.1| putative Ribonucleoside-diphosphate reductase (ribonucleoside
           diphosphate reductase, beta subunit) [Thiomonas sp. 3As]
          Length = 410

 Score =  193 bits (490), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID++NQIK+ENPHLWT EF+++   + H+A  LE  YA
Sbjct: 275 MTGAAEQYQYILRDESMHTNFGIDLVNQIKLENPHLWTPEFKRELTGLFHQAVELEYRYA 334

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FIANRR  QIGL+ +F   ENPFPWMSE+IDLKKE+NFF
Sbjct: 335 EDTMPRGVLGLNASMFKGYLRFIANRRAVQIGLDAIFPNEENPFPWMSEMIDLKKERNFF 394

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 395 ETRVIEYQSGGALSWE 410


>gi|34497739|ref|NP_901954.1| ribonucleotide-diphosphate reductase subunit beta [Chromobacterium
           violaceum ATCC 12472]
 gi|34103595|gb|AAQ59956.1| ribonucleoside-diphosphate reductase system [Chromobacterium
           violaceum ATCC 12472]
          Length = 360

 Score =  193 bits (490), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN IK+ENP LWT  F+ +   +  +A  LE AYA
Sbjct: 225 MTGAAEQYQYILRDESMHCNFGIDLINTIKLENPLLWTDSFKAEIVDLFKQAVELEYAYA 284

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRR  QIGL+PLF    NPFPWMSE+IDLKKEKNFF
Sbjct: 285 EDTMPRGVLGLNASMFKEYLRFIANRRMQQIGLDPLFPGVNNPFPWMSEMIDLKKEKNFF 344

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 345 ETRVTEYQTGGALSWD 360


>gi|296135014|ref|YP_003642256.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
 gi|295795136|gb|ADG29926.1| Ribonucleoside-diphosphate reductase [Thiomonas intermedia K12]
          Length = 402

 Score =  193 bits (490), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID++NQIK+ENPHLWT EF+++   + H+A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESMHTNFGIDLVNQIKLENPHLWTPEFKRELTGLFHQAVELEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y++FIANRR  QIGL+ +F   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNASMFKGYLRFIANRRAVQIGLDAIFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 387 ETRVIEYQSGGALSWE 402


>gi|299533977|ref|ZP_07047329.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
 gi|298717886|gb|EFI58891.1| ribonucleotide-diphosphate reductase subunit beta [Comamonas
           testosteroni S44]
          Length = 363

 Score =  193 bits (490), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+Q+   +  +A  LE  YA
Sbjct: 228 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKQEITELFQKAVELEYRYA 287

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 288 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFPGEENPFPWMSEMIDLKKERNFF 347

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 348 ETRVIEYQTGGALSWD 363


>gi|91787004|ref|YP_547956.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas sp.
           JS666]
 gi|91696229|gb|ABE43058.1| Ribonucleoside-diphosphate reductase [Polaromonas sp. JS666]
          Length = 406

 Score =  193 bits (490), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+ + + +  +A  LE  YA
Sbjct: 271 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKAEIKALFLKAVELEYRYA 330

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 331 EDTMPRGVLGLNASMFKGYLRYIANRRATQIGLETLFPNEENPFPWMSEMIDLKKERNFF 390

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 391 ETRVIEYQSGGALSWD 406


>gi|119478322|ref|ZP_01618353.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
 gi|119448662|gb|EAW29907.1| ribonucleotide-diphosphate reductase beta subunit [marine gamma
           proteobacterium HTCC2143]
          Length = 422

 Score =  192 bits (489), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 111/136 (81%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIK+ENP LW+++FQQ+   M+ E T LEI YA
Sbjct: 287 MTGVAEQFQYILRDESMHLNFGIDVINQIKLENPQLWSEKFQQEIIQMILEGTQLEIEYA 346

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            ++MP+G +G+NA   E+Y+QFI+NRR +Q+GL   ++  +NPFPWMSE++DL+KEKNFF
Sbjct: 347 RDSMPRGVLGMNAAMMEEYLQFISNRRLNQLGLPEQYQGAQNPFPWMSEIMDLRKEKNFF 406

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 407 ETRVIEYQTGGALNWE 422


>gi|126640804|ref|YP_001083788.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii ATCC 17978]
 gi|322506921|gb|ADX02375.1| nrdB [Acinetobacter baumannii 1656-2]
 gi|323516789|gb|ADX91170.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 361

 Score =  192 bits (489), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 227 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 286

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 287 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 346

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 347 ETRVTDYQTGGALSW 361


>gi|262280153|ref|ZP_06057938.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260504|gb|EEY79237.1| ribonucleoside-diphosphate reductase beta subunit [Acinetobacter
           calcoaceticus RUH2202]
          Length = 427

 Score =  192 bits (489), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLW+ EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWSAEFQQEVVQMIVEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|221065168|ref|ZP_03541273.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
 gi|220710191|gb|EED65559.1| Ribonucleoside-diphosphate reductase [Comamonas testosteroni KF-1]
          Length = 363

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+Q+   +   A  LE  YA
Sbjct: 228 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKQEITELFQRAVELEYRYA 287

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 288 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFPGEENPFPWMSEMIDLKKERNFF 347

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 348 ETRVIEYQTGGALSWD 363


>gi|224825450|ref|ZP_03698555.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
 gi|224602371|gb|EEG08549.1| Ribonucleoside-diphosphate reductase [Lutiella nitroferrum 2002]
          Length = 360

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN +K ENP LWT+EF+ +   +   A  LE AYA
Sbjct: 225 MTGAAEQYQYILRDESMHCNFGIDLINTVKQENPQLWTEEFKAEITGLFKHAVELEYAYA 284

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRR  QIGLEP+F    NPFPWMSE+IDLKKEKNFF
Sbjct: 285 EDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGLEPMFPGVTNPFPWMSEMIDLKKEKNFF 344

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 345 ETRVTEYQTGGALSWD 360


>gi|255019430|ref|ZP_05291537.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254971128|gb|EET28583.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 345

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 110/136 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG AEQYQYI+RDES+H NFGID+INQIK+ENP LWT+ FQQ+   ++ +   LE AYA
Sbjct: 209 MVGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTEGFQQEIVGLIRQGVELECAYA 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  ++Y+++I NRR  QIGL+P ++  +NPFPWMSE++DLKKEKNFF
Sbjct: 269 DDTMPRGILGLNAPMFKEYVRYIGNRRLSQIGLKPQWENVQNPFPWMSEMMDLKKEKNFF 328

Query: 121 ETRVTEYQQGAGLKWD 136
           E+RVT+YQ G  L WD
Sbjct: 329 ESRVTDYQTGGALSWD 344


>gi|326315613|ref|YP_004233285.1| ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372449|gb|ADX44718.1| Ribonucleoside-diphosphate reductase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 387

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+++ + +  +A  LE  YA
Sbjct: 252 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKEEIKGLFMKAVELEYQYA 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 312 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 371

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 372 ETRVIEYQSGGALSWD 387


>gi|299771426|ref|YP_003733452.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
 gi|298701514|gb|ADI92079.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. DR1]
          Length = 427

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLW+ EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWSAEFQQEVVQMIVEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|88812072|ref|ZP_01127324.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
 gi|88790576|gb|EAR21691.1| ribonucleotide-diphosphate reductase beta subunit [Nitrococcus
           mobilis Nb-231]
          Length = 370

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGIDVINQIK ENPHLWT EFQ  ++  + E+  LE+ YA
Sbjct: 235 MTGTAEQFQYILRDESIHLNFGIDVINQIKQENPHLWTAEFQATAQRTILESMALEVDYA 294

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +T+P+G +GLNA   E+Y++FI NRR  QIGL   F   ENP PWMSE++DLKKEKNFF
Sbjct: 295 RDTLPRGVLGLNAAMIEEYLRFITNRRLAQIGLTEAFPGAENPLPWMSELVDLKKEKNFF 354

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEY+ G  L W+
Sbjct: 355 ETRVTEYRTGGALSWE 370


>gi|120609557|ref|YP_969235.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           citrulli AAC00-1]
 gi|120588021|gb|ABM31461.1| Ribonucleoside-diphosphate reductase [Acidovorax citrulli AAC00-1]
          Length = 387

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+++ + +  +A  LE  YA
Sbjct: 252 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKEEIKGLFMKAVELEYQYA 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 312 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 371

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 372 ETRVIEYQSGGALSWD 387


>gi|121595925|ref|YP_987821.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax sp.
           JS42]
 gi|222112113|ref|YP_002554377.1| ribonucleotide-diphosphate reductase subunit beta [Acidovorax
           ebreus TPSY]
 gi|120608005|gb|ABM43745.1| Ribonucleoside-diphosphate reductase [Acidovorax sp. JS42]
 gi|221731557|gb|ACM34377.1| Ribonucleoside-diphosphate reductase [Acidovorax ebreus TPSY]
          Length = 396

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+ + + +  +A  LE  YA
Sbjct: 261 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKDEIKALFIKAVELEYRYA 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 321 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 380

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 381 ETRVIEYQSGGALSWD 396


>gi|332039867|gb|EGI76262.1| ribonucleotide-diphosphate reductase subunit beta [Hylemonella
           gracilis ATCC 19624]
          Length = 399

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + R +  +A  LE  YA
Sbjct: 264 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTPEFKAEIRGLFEKAVELEYRYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 324 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 383

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 384 ETRVIEYQSGGALSWD 399


>gi|264680215|ref|YP_003280125.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
 gi|262210731|gb|ACY34829.1| ribonucleotide reductase [Comamonas testosteroni CNB-2]
          Length = 336

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+Q+   +  +A  LE  YA
Sbjct: 201 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKQEITELFQKAVELEYRYA 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 261 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEELFPGEENPFPWMSEMIDLKKERNFF 320

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 321 ETRVIEYQTGGALSWD 336


>gi|124268397|ref|YP_001022401.1| ribonucleotide-diphosphate reductase subunit beta [Methylibium
           petroleiphilum PM1]
 gi|124261172|gb|ABM96166.1| Ribonucleoside-diphosphate reductase [Methylibium petroleiphilum
           PM1]
          Length = 403

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT EF+ + + +  +A  LE  YA
Sbjct: 268 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTAEFKAEIKALFMKAVELEYRYA 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 328 EDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEELFPNEENPFPWMSEMIDLKKERNFF 387

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 388 ETRVIEYQSGGALSWD 403


>gi|226945386|ref|YP_002800459.1| ribonucleotide-diphosphate reductase subunit beta [Azotobacter
           vinelandii DJ]
 gi|226720313|gb|ACO79484.1| Ribonucleoside-diphosphate reductase beta subunit [Azotobacter
           vinelandii DJ]
          Length = 416

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGID+INQIKIENPHLW  E + ++  M+ + T LEI YA
Sbjct: 281 MTGTAEQFQYILRDESMHLNFGIDMINQIKIENPHLWDAEMKDEATQMILQGTQLEIEYA 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E Y++FIANRR  Q+GL   +  T NPFPWMSE++DLKKEKNFF
Sbjct: 341 RDTMPRGVLGMNATMMEDYLKFIANRRLSQLGLPEQYPGTTNPFPWMSEIMDLKKEKNFF 400

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 401 ETRVIEYQTGGALSWD 416


>gi|241764092|ref|ZP_04762129.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
 gi|241366556|gb|EER61044.1| Ribonucleoside-diphosphate reductase [Acidovorax delafieldii 2AN]
          Length = 398

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENPHLWT EF+ + + +   A  LE  YA
Sbjct: 263 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPHLWTAEFKAEIKALFMRAVELEYRYA 322

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 323 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLETLFPNEENPFPWMSEMIDLKKERNFF 382

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 383 ETRVIEYQSGGALSWD 398


>gi|158341282|ref|YP_001522354.1| ribonucleotide-diphosphate reductase subunit beta [Acaryochloris
           marina MBIC11017]
 gi|158311523|gb|ABW33134.1| ribonucleoside-diphosphate reductase, beta subunit [Acaryochloris
           marina MBIC11017]
          Length = 384

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID++N IK ENPHLWT EF ++ R +   A  LE  YA
Sbjct: 249 MTGAAEQYQYILRDESMHCNFGIDLVNAIKQENPHLWTPEFCEEIRDLFKRAVELEYRYA 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+++IANRR  QIGL+P+F   ENPFPWMSE++DLKKE+NFF
Sbjct: 309 EDTMPRGVLGLNASMFKSYLRYIANRRSQQIGLDPIFASEENPFPWMSEMVDLKKERNFF 368

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 369 ETRVLEYQTGGALSWD 384


>gi|50083944|ref|YP_045454.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. ADP1]
 gi|49529920|emb|CAG67632.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           sp. ADP1]
          Length = 427

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 108/135 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++EQ+QYI+RDES+H+NFGID+INQIKIENPHLWT EFQQ+   M+ E TLLEI YA
Sbjct: 293 MNGVSEQFQYILRDESMHVNFGIDMINQIKIENPHLWTAEFQQEVIQMIVEGTLLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   ++   NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNAAMMEEYLKFICNRRLAQLGLPEQYRGVNNPFQWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|313200886|ref|YP_004039544.1| ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
 gi|312440202|gb|ADQ84308.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. MP688]
          Length = 381

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN +K+ENPHLWT EF+++ + ++ +A  LE  YA
Sbjct: 246 MQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHLWTPEFREEIKRLMQQAVELEYRYA 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRR  QIG++ L+    NPFPWMSE++DLKKEKNFF
Sbjct: 306 EDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDALYPGASNPFPWMSEMMDLKKEKNFF 365

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 366 ETRVTEYQTGGALSWD 381


>gi|253998799|ref|YP_003050862.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
 gi|253985478|gb|ACT50335.1| Ribonucleoside-diphosphate reductase [Methylovorus sp. SIP3-4]
          Length = 383

 Score =  191 bits (484), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 108/136 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN +K+ENPHLWT EF+++ + ++ +A  LE  YA
Sbjct: 248 MQGAAEQYQYILRDESMHCNFGIDLINTLKLENPHLWTPEFREEIKRLMQQAVELEYRYA 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   ++Y++FIANRR  QIG++ L+    NPFPWMSE++DLKKEKNFF
Sbjct: 308 EDTMPRGVLGLNAAMFKEYLRFIANRRMQQIGIDALYPGASNPFPWMSEMMDLKKEKNFF 367

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 368 ETRVTEYQTGGALSWD 383


>gi|145588393|ref|YP_001154990.1| ribonucleotide-diphosphate reductase subunit beta [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046799|gb|ABP33426.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 394

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT  F+ + +++  +A  LE  YA
Sbjct: 259 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTSAFKDEIKSIFEKAVELEYRYA 318

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y+++I NRRC QIGL+ +F   ENPFPWMSE+IDLKKE+NFF
Sbjct: 319 EDTMPRGVLGLNAPMFKGYLRYICNRRCLQIGLDAMFPNEENPFPWMSEMIDLKKERNFF 378

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 379 ETRVIEYQTGGALSWE 394


>gi|294840478|ref|ZP_06785161.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           sp. 6014059]
          Length = 427

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 106/135 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT EFQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMS ++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWMSGMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|89902117|ref|YP_524588.1| ribonucleotide-diphosphate reductase subunit beta [Rhodoferax
           ferrireducens T118]
 gi|89346854|gb|ABD71057.1| Ribonucleoside-diphosphate reductase [Rhodoferax ferrireducens
           T118]
          Length = 400

 Score =  190 bits (483), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT EF+ + + +  +A  LE  YA
Sbjct: 265 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWTSEFKAEIKALFEQAVELEYRYA 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 325 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLETLFPNEENPFPWMSEMIDLKKERNFF 384

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 385 ETRVIEYQSGGALSWD 400


>gi|212212091|ref|YP_002303027.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuG_Q212]
 gi|212010501|gb|ACJ17882.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuG_Q212]
          Length = 401

 Score =  190 bits (483), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLW K FQ++   M+ E   LE  YA
Sbjct: 265 MTGTSEQFQYILRDESMHVNFGIDVINQIKIENPHLWNKNFQKEVIEMILEGVELEYQYA 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+Q+IANRRC QIGL   F   +N FPWMSE++DLKKEKNFF
Sbjct: 325 KDTMPRGILGLNANMFKDYLQYIANRRCAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFF 384

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  LKWD
Sbjct: 385 ETRVIEYQAGGTLKWD 400


>gi|226953559|ref|ZP_03824023.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|294649451|ref|ZP_06726876.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226835696|gb|EEH68079.1| ribonucleotide reductase, beta subunit [Acinetobacter sp. ATCC
           27244]
 gi|292824656|gb|EFF83434.1| ribonucleotide-diphosphate reductase beta subunit [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 427

 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 106/135 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENPHLWT  FQQ+   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTATFQQEVIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNASMMEEYLKFICNRRLAQLGLPEQFAGVTNPFQWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|29654845|ref|NP_820537.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 493]
 gi|154705923|ref|YP_001423853.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii Dugway 5J108-111]
 gi|161831080|ref|YP_001597389.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii RSA 331]
 gi|29542113|gb|AAO91051.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           RSA 493]
 gi|154355209|gb|ABS76671.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           Dugway 5J108-111]
 gi|161762947|gb|ABX78589.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 331]
          Length = 401

 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLW K FQ++   M+ E   LE  YA
Sbjct: 265 MTGTSEQFQYILRDESMHVNFGIDVINQIKIENPHLWNKNFQKEVIEMILEGVELEYQYA 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+Q+IANRRC QIGL   F   +N FPWMSE++DLKKEKNFF
Sbjct: 325 KDTMPRGILGLNANMFKDYLQYIANRRCAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFF 384

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  LKWD
Sbjct: 385 ETRVIEYQAGGTLKWD 400


>gi|153208286|ref|ZP_01946665.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165919229|ref|ZP_02219315.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212219268|ref|YP_002306055.1| ribonucleotide-diphosphate reductase subunit beta [Coxiella
           burnetii CbuK_Q154]
 gi|120576070|gb|EAX32694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii 'MSU Goat Q177']
 gi|165917090|gb|EDR35694.1| ribonucleoside-diphosphate reductase, beta subunit [Coxiella
           burnetii RSA 334]
 gi|212013530|gb|ACJ20910.1| ribonucleoside-diphosphate reductase beta chain [Coxiella burnetii
           CbuK_Q154]
          Length = 401

 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLW K FQ++   M+ E   LE  YA
Sbjct: 265 MTGTSEQFQYILRDESMHVNFGIDVINQIKIENPHLWNKNFQKEVIEMILEGVELEYQYA 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+Q+IANRRC QIGL   F   +N FPWMSE++DLKKEKNFF
Sbjct: 325 KDTMPRGILGLNANMFKDYLQYIANRRCAQIGLPEQFPGAKNTFPWMSEMMDLKKEKNFF 384

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  LKWD
Sbjct: 385 ETRVIEYQAGGTLKWD 400


>gi|52842002|ref|YP_095801.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629113|gb|AAU27854.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 381

 Score =  189 bits (481), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+ +   ++ E   LE  YA
Sbjct: 244 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFKNEMIQLIREGVELEYQYA 303

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   E+Y+ FIANRR +QIGL   +   ENPFPWMSE++DLKKEKNFF
Sbjct: 304 RDTMPHGILGMNAEMFEEYLHFIANRRLNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFF 363

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 364 ETRVIEYQAGGTLSWD 379


>gi|332110818|gb|EGJ10995.1| ribonucleotide-diphosphate reductase subunit beta [Rubrivivax
           benzoatilyticus JA2]
          Length = 385

 Score =  189 bits (481), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 103/136 (75%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT  F+ + R +   A  LE  YA
Sbjct: 250 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWTPAFKAEIRALFERAVELEYRYA 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 310 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 369

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV +YQ G  L WD
Sbjct: 370 ETRVIDYQSGGALSWD 385


>gi|121606275|ref|YP_983604.1| ribonucleotide-diphosphate reductase subunit beta [Polaromonas
           naphthalenivorans CJ2]
 gi|120595244|gb|ABM38683.1| Ribonucleoside-diphosphate reductase [Polaromonas naphthalenivorans
           CJ2]
          Length = 387

 Score =  189 bits (481), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT EF+ +   +  +A  LE  YA
Sbjct: 252 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWTAEFKAEINALFMKAVELEYRYA 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 312 EDTMPRGVLGLNASMFKGYLRYIANRRATQIGLETLFPNEENPFPWMSEMIDLKKERNFF 371

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 372 ETRVIEYQSGGALSWD 387


>gi|148359319|ref|YP_001250526.1| ribonucleoside-diphosphate reductase subunit beta [Legionella
           pneumophila str. Corby]
 gi|296107366|ref|YP_003619066.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281092|gb|ABQ55180.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           pneumophila str. Corby]
 gi|295649267|gb|ADG25114.1| ribonucleoside-diphosphate reductase beta chain [Legionella
           pneumophila 2300/99 Alcoy]
 gi|307610475|emb|CBX00047.1| hypothetical protein LPW_18021 [Legionella pneumophila 130b]
          Length = 367

 Score =  189 bits (481), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+ +   ++ E   LE  YA
Sbjct: 230 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFKNEMIQLIREGVELEYQYA 289

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   E+Y+ FIANRR +QIGL   +   ENPFPWMSE++DLKKEKNFF
Sbjct: 290 RDTMPHGILGMNAEMFEEYLHFIANRRLNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFF 349

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 350 ETRVIEYQAGGTLSWD 365


>gi|54294662|ref|YP_127077.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Lens]
 gi|53754494|emb|CAH15978.1| hypothetical protein lpl1739 [Legionella pneumophila str. Lens]
          Length = 367

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+ +   ++ E   LE  YA
Sbjct: 230 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFKNEIIQLIREGVELEYQYA 289

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   E+Y+ FIANRR +QIGL   +   ENPFPWMSE++DLKKEKNFF
Sbjct: 290 RDTMPHGILGMNAEMFEEYLHFIANRRLNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFF 349

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 350 ETRVIEYQAGGTLSWD 365


>gi|54297688|ref|YP_124057.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           pneumophila str. Paris]
 gi|53751473|emb|CAH12891.1| hypothetical protein lpp1739 [Legionella pneumophila str. Paris]
          Length = 367

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/136 (63%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+ +   ++ E   LE  YA
Sbjct: 230 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFKNEIIQLIREGVELEYQYA 289

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   E+Y+ FIANRR +QIGL   +   ENPFPWMSE++DLKKEKNFF
Sbjct: 290 RDTMPHGILGMNAEMFEEYLHFIANRRLNQIGLPDQYPGAENPFPWMSEMLDLKKEKNFF 349

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 350 ETRVIEYQAGGTLSWD 365


>gi|262376783|ref|ZP_06070011.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
 gi|262308493|gb|EEY89628.1| ribonucleoside-diphosphate reductase, beta subunit [Acinetobacter
           lwoffii SH145]
          Length = 427

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 107/135 (79%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENP LWT EFQ++   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPGLWTTEFQEEIIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FIANRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNAGMMEEYLKFIANRRLAQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|171057074|ref|YP_001789423.1| ribonucleotide-diphosphate reductase subunit beta [Leptothrix
           cholodnii SP-6]
 gi|170774519|gb|ACB32658.1| Ribonucleoside-diphosphate reductase [Leptothrix cholodnii SP-6]
          Length = 402

 Score =  189 bits (479), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+IN IK+ENPHLWT  F+ + + +  +A  LE  YA
Sbjct: 267 MTGAAEQYQYILRDESMHCNFGIDLINAIKLENPHLWTPAFKAEIKALFLKAVELEYRYA 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 327 EDTMPRGVLGLNASMFKGYLRYIANRRATQIGLEELFPNEENPFPWMSEMIDLKKERNFF 386

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 387 ETRVIEYQSGGALSWD 402


>gi|239813962|ref|YP_002942872.1| ribonucleotide-diphosphate reductase subunit beta [Variovorax
           paradoxus S110]
 gi|239800539|gb|ACS17606.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus S110]
          Length = 391

 Score =  189 bits (479), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT EF+ + + +  +A  LE  YA
Sbjct: 256 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWTPEFKAEIKALFLKAVELEYKYA 315

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 316 EDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFPNEENPFPWMSEMIDLKKERNFF 375

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 376 ETRVIEYQSGGALSWD 391


>gi|319791701|ref|YP_004153341.1| ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
 gi|315594164|gb|ADU35230.1| Ribonucleoside-diphosphate reductase [Variovorax paradoxus EPS]
          Length = 411

 Score =  188 bits (478), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT EF+ + + +   A  LE  YA
Sbjct: 276 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPGLWTPEFKAEIKDLFMRAVELEYKYA 335

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 336 EDTMPRGVLGMNASMFKGYLRYIANRRAQQIGLETLFPNEENPFPWMSEMIDLKKERNFF 395

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 396 ETRVIEYQSGGALSWD 411


>gi|254496936|ref|ZP_05109775.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
 gi|254353845|gb|EET12541.1| ribonucleotide-diphosphate reductase subunit beta [Legionella
           drancourtii LLAP12]
          Length = 369

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 106/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+++   ++ +   +E  YA
Sbjct: 229 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPEFKEEIIQLIKDGVAMEYQYA 288

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   E+Y+ FIANRR +QIGL   +   ENPFPWMSE++DLKKEKNFF
Sbjct: 289 KDTMPHGILGMNAEMFEEYLHFIANRRLNQIGLPEQYPGAENPFPWMSEMMDLKKEKNFF 348

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 349 ETRVIEYQAGGTLSWD 364


>gi|160896947|ref|YP_001562529.1| ribonucleotide-diphosphate reductase subunit beta [Delftia
           acidovorans SPH-1]
 gi|160362531|gb|ABX34144.1| Ribonucleoside-diphosphate reductase [Delftia acidovorans SPH-1]
          Length = 363

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT EF+++   +  +A  LE  YA
Sbjct: 228 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWTPEFKEEITALFVKAVELEYRYA 287

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGLE LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 288 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLEALFPNEENPFPWMSEMIDLKKERNFF 347

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 348 ETRVIEYQTGGALSWD 363


>gi|262369327|ref|ZP_06062655.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
 gi|262315395|gb|EEY96434.1| ribonucleotide-diphosphate reductase small subunit [Acinetobacter
           johnsonii SH046]
          Length = 427

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 106/135 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGID+INQIKIENP LWT EFQ++   M+ E T+LEI YA
Sbjct: 293 MNGVAEQFQYILRDESMHLNFGIDMINQIKIENPSLWTAEFQEEIIQMILEGTMLEIEYA 352

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y++FI NRR  Q+GL   F    NPF WMSE++DL+KEKNFF
Sbjct: 353 RDTMPRGVLGMNAAMMEEYLKFICNRRLAQLGLPEQFAGVNNPFQWMSEMMDLRKEKNFF 412

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ G  L W
Sbjct: 413 ETRVTDYQTGGALSW 427


>gi|255019898|ref|ZP_05291973.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970678|gb|EET28165.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Acidithiobacillus caldus ATCC 51756]
          Length = 374

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 107/136 (78%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG AEQYQYI+RDES+H NFGID+INQIK+ENP LWT+ FQ++  +++ +   LE AYA
Sbjct: 239 MVGAAEQYQYILRDESMHCNFGIDLINQIKVENPDLWTEPFQEEIVSLIRKGVELECAYA 298

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  + Y+++I NRR  Q+GL   +   +NPFPWMSE++DLKKEKNFF
Sbjct: 299 DDTMPRGVLGLNAPIFKDYVKYIGNRRLQQLGLPVQWAGIQNPFPWMSEMMDLKKEKNFF 358

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 359 ETRVTEYQTGGALSWD 374


>gi|270156779|ref|ZP_06185436.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|289164772|ref|YP_003454910.1| ribonucleoside-diphosphate reductase, beta subunit [Legionella
           longbeachae NSW150]
 gi|269988804|gb|EEZ95058.1| ribonucleotide-diphosphate reductase beta subunit [Legionella
           longbeachae D-4968]
 gi|288857945|emb|CBJ11805.1| putative ribonucleoside-diphosphate reductase, beta subunit
           [Legionella longbeachae NSW150]
          Length = 366

 Score =  187 bits (474), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 105/136 (77%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +EQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT EF+++   ++ +   LE  YA
Sbjct: 229 MVGTSEQFQYILRDESMHMNFGIDVINQIKIENPHLWTSEFKEEIIQLIRQGVDLEYQYA 288

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   E+Y+ FIANRR  QIGL   +    NPFPWMSE++DLKKEKNFF
Sbjct: 289 KDTMPQGILGMNAEMFEEYLHFIANRRLTQIGLAEQYPGAVNPFPWMSEMMDLKKEKNFF 348

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 349 ETRVIEYQAGGTLSWD 364


>gi|171463021|ref|YP_001797134.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192559|gb|ACB43520.1| Ribonucleoside-diphosphate reductase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 394

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LW   F+ + +++  +A  LE  YA
Sbjct: 259 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPQLWISAFKDEIKSIFEKAVELEYRYA 318

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP  +  +++I NRRC QIGL+ +F   ENPFPWMSE+IDLKKE+NFF
Sbjct: 319 EDTMPRGVLGLNAPMFKGCLRYICNRRCLQIGLDAMFPNEENPFPWMSEMIDLKKERNFF 378

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L W+
Sbjct: 379 ETRVIEYQTGGALSWE 394


>gi|319764328|ref|YP_004128265.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|330826374|ref|YP_004389677.1| ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
 gi|317118889|gb|ADV01378.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           BC]
 gi|329311746|gb|AEB86161.1| Ribonucleoside-diphosphate reductase [Alicycliphilus denitrificans
           K601]
          Length = 396

 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQ+K+ENP LWT  F+ + + +  +A  LE  YA
Sbjct: 261 MTGAAEQYQYILRDESMHCNFGIDLINQLKLENPQLWTPAFKDEIKGLFLKAVDLEYRYA 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +G+NA   + Y+++IANRR  QIGL+ LF   ENPFPWMSE+IDLKKE+NFF
Sbjct: 321 EDTMPRGVLGMNASMFKGYLRYIANRRATQIGLDALFPNEENPFPWMSEMIDLKKERNFF 380

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 381 ETRVIEYQTGGALSWD 396


>gi|218665361|ref|YP_002427016.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|218517574|gb|ACK78160.1| ribonucleoside-diphosphate reductase, beta subunit
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 380

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT+ FQQ+   ++     LE AYA
Sbjct: 245 MVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWTEAFQQEIIDLIRRGVELECAYA 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP   +Y+++I NRR  Q+GL   +   +NPFPWMSE++DLKKEKNFF
Sbjct: 305 DDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYPGVQNPFPWMSEMMDLKKEKNFF 364

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L W+
Sbjct: 365 ETRVTEYQTGGALSWE 380


>gi|198284354|ref|YP_002220675.1| ribonucleotide-diphosphate reductase subunit beta
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|198248875|gb|ACH84468.1| Ribonucleoside-diphosphate reductase [Acidithiobacillus
           ferrooxidans ATCC 53993]
          Length = 374

 Score =  184 bits (467), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG AEQYQYI+RDES+H NFGID+ NQIK+ENP LWT+ FQQ+   ++     LE AYA
Sbjct: 239 MVGAAEQYQYILRDESMHCNFGIDMANQIKVENPQLWTEAFQQEIIDLIRRGVELECAYA 298

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLNAP   +Y+++I NRR  Q+GL   +   +NPFPWMSE++DLKKEKNFF
Sbjct: 299 DDTMPRGVLGLNAPVFREYVKYIGNRRLVQLGLPQQYPGVQNPFPWMSEMMDLKKEKNFF 358

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L W+
Sbjct: 359 ETRVTEYQTGGALSWE 374


>gi|149927167|ref|ZP_01915424.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
 gi|149824106|gb|EDM83327.1| ribonucleotide-diphosphate reductase beta subunit [Limnobacter sp.
           MED105]
          Length = 399

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G AEQ+QYI+RDES H  FGID+IN +K+ENPHLWT EF+++ + M  +A  LE AYA
Sbjct: 264 MIGAAEQFQYILRDESAHCTFGIDLINTVKLENPHLWTPEFKEEIKAMFRKAVELEHAYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP+G +GLN+    +YM+FI NRR +QIGL  L++   NPFPWMSE++DLKKE NFF
Sbjct: 324 VDTMPRGVLGLNSAQFMEYMKFICNRRSNQIGLGTLYEGATNPFPWMSEMMDLKKETNFF 383

Query: 121 ETRVTEYQQGAGLKWD 136
           E RVTEYQ G  L WD
Sbjct: 384 ERRVTEYQTGGALSWD 399


>gi|160871658|ref|ZP_02061790.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
 gi|159120457|gb|EDP45795.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsiella
           grylli]
          Length = 362

 Score =  184 bits (466), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 85/136 (62%), Positives = 101/136 (74%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+HLNFGIDVINQIK+ENPHLWT EF++    ++ E   LE  YA
Sbjct: 226 MTGTAEQFQYILRDESMHLNFGIDVINQIKLENPHLWTPEFKRYVINLIKEGVDLEYQYA 285

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +T+P+G +GLNA     Y++FI NRR  QIGL   +    NP PWMSE+IDLKKEKNFF
Sbjct: 286 LDTLPRGILGLNANLMWDYLRFIGNRRFTQIGLAEQYPGVSNPLPWMSEIIDLKKEKNFF 345

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 346 ETRVTEYQTGGSLNWD 361


>gi|268316001|ref|YP_003289720.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
 gi|262333535|gb|ACY47332.1| Ribonucleoside-diphosphate reductase [Rhodothermus marinus DSM
           4252]
          Length = 347

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN IK ENP LWT EFQ++ + ++ EA  LE+AYA
Sbjct: 212 MTGIGEQFQYILRDETIHLNFGIDLINGIKAENPELWTPEFQREVQQLIEEAVELEVAYA 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           ++ +P+G +GL AP   +Y+Q+IA+RR  +IGL+  +  ++NPFPWMSE IDL KEKNFF
Sbjct: 272 YDCLPRGVLGLTAPMFREYVQYIADRRLERIGLKARYG-SKNPFPWMSETIDLLKEKNFF 330

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQQ A L WD
Sbjct: 331 ETRVTEYQQAAALSWD 346


>gi|121608466|ref|YP_996273.1| ribonucleotide-diphosphate reductase subunit beta
           [Verminephrobacter eiseniae EF01-2]
 gi|121553106|gb|ABM57255.1| Ribonucleoside-diphosphate reductase [Verminephrobacter eiseniae
           EF01-2]
          Length = 399

 Score =  182 bits (461), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 84/136 (61%), Positives = 101/136 (74%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDES+H NFGID+INQIK+ENP LWT  F+ +   +  +A  LE  YA
Sbjct: 264 MTGAAEQYQYILRDESMHCNFGIDLINQIKLENPLLWTTAFKAEIEALFLQAVELEYRYA 323

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +TMP G +G+NA   + Y+++IANRR  QIGLE LF    NPFPWMSE+IDLKKE+NFF
Sbjct: 324 EDTMPHGVLGMNASMFKGYLRYIANRRATQIGLETLFPQETNPFPWMSEMIDLKKERNFF 383

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G  L WD
Sbjct: 384 ETRVIEYQSGGALCWD 399


>gi|15834835|ref|NP_296594.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270285001|ref|ZP_06194395.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Nigg]
 gi|270289024|ref|ZP_06195326.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum Weiss]
 gi|301336399|ref|ZP_07224601.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           muridarum MopnTet14]
 gi|14195147|sp|Q9PL92|RIR2_CHLMU RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|7190253|gb|AAF39087.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydia
           muridarum Nigg]
          Length = 346

 Score =  176 bits (446), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 82/135 (60%), Positives = 102/135 (75%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGI EQYQYI+RDE++HLNFG+D+IN IK ENP +WT E QQ+   M+  A  LEI YA
Sbjct: 213 MVGIGEQYQYILRDETIHLNFGVDLINGIKEENPEIWTTELQQEIIEMIQRAVDLEIDYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFF
Sbjct: 273 RDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ  A L W
Sbjct: 332 ETRVTEYQHAASLTW 346


>gi|298243909|ref|ZP_06967716.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
 gi|297556963|gb|EFH90827.1| Ribonucleoside-diphosphate reductase [Ktedonobacter racemifer DSM
           44963]
          Length = 361

 Score =  175 bits (443), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 103/136 (75%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ EQ+QYI+RDE++HLNFGID+IN IK ENP LWT EFQ     ++  A  LEIAYA
Sbjct: 227 MTGVGEQFQYILRDETIHLNFGIDLINGIKAENPELWTTEFQAHIYDLIKRAVELEIAYA 286

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           ++ +P G +GLNA S   Y+Q +A+RR  +IGL P+F ++ +PFPWMSE +DL KEKNFF
Sbjct: 287 YDCLPNGILGLNAESFRSYVQHVADRRLERIGLAPIF-HSSHPFPWMSETMDLSKEKNFF 345

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ  + L+W+
Sbjct: 346 ETRVTEYQAASTLEWE 361


>gi|166154172|ref|YP_001654290.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 434/Bu]
 gi|166155047|ref|YP_001653302.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
 gi|301335416|ref|ZP_07223660.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis L2tet1]
 gi|165930160|emb|CAP03644.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis 434/Bu]
 gi|165931035|emb|CAP06598.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis L2b/UCH-1/proctitis]
          Length = 346

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (75%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E QQ+   ++  A  LEI YA
Sbjct: 213 MIGIGEQYQYILRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFF
Sbjct: 273 QDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ  A L W
Sbjct: 332 ETRVTEYQHAASLTW 346


>gi|282890382|ref|ZP_06298910.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499764|gb|EFB42055.1| hypothetical protein pah_c016o114 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 350

 Score =  174 bits (440), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 82/135 (60%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDES+HLNFGID+IN IK ENP +WT EF+ +   M+ EA  LEI YA
Sbjct: 217 MTGIGEQFQYILRDESIHLNFGIDLINTIKEENPEVWTPEFKDQIIDMVKEAVELEIQYA 276

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P G +GLNA     Y+ +IA+RR  +IGL+P +  T NPFPWMSEV+DL KEKNFF
Sbjct: 277 ADCLPNGILGLNAALFRDYVGYIADRRLERIGLKPQYN-TANPFPWMSEVMDLDKEKNFF 335

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVT+YQ GA L W
Sbjct: 336 ETRVTQYQSGAALVW 350


>gi|112489977|pdb|2ANI|A Chain A, Crystal Structure Of The F127y Mutant Of Ribonucleotide
           Reductase R2 From Chlamydia Trachomatis
          Length = 346

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E QQ+   ++  A  LEI YA
Sbjct: 213 MIGIGEQYQYILRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFF
Sbjct: 273 QDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 332 ETRVIEYQHAASLTW 346


>gi|15605563|ref|NP_220349.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D/UW-3/CX]
 gi|255311668|ref|ZP_05354238.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276]
 gi|255317969|ref|ZP_05359215.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 6276s]
 gi|14195107|sp|O84835|RIR2_CHLTR RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|51247460|pdb|1SYY|A Chain A, Crystal Structure Of The R2 Subunit Of Ribonucleotide
           Reductase From Chlamydia Trachomatis
 gi|3329298|gb|AAC68425.1| Ribonucleoside Reductase, Small Chain [Chlamydia trachomatis
           D/UW-3/CX]
 gi|296436383|gb|ADH18557.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9768]
 gi|296437314|gb|ADH19484.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11222]
 gi|296438242|gb|ADH20403.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/11074]
 gi|297140743|gb|ADH97501.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis G/9301]
 gi|297748957|gb|ADI51503.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-EC]
 gi|297749837|gb|ADI52515.1| Ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis D-LC]
          Length = 346

 Score =  172 bits (436), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E QQ+   ++  A  LEI YA
Sbjct: 213 MIGIGEQYQYILRDETIHLNFGIDLINGIKEENPEIWTPELQQEIVELIKRAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFF
Sbjct: 273 QDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 332 ETRVIEYQHAASLTW 346


>gi|76789573|ref|YP_328659.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis A/HAR-13]
 gi|237803260|ref|YP_002888454.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/Jali20/OT]
 gi|237805181|ref|YP_002889335.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|255349232|ref|ZP_05381239.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70]
 gi|255503769|ref|ZP_05382159.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis 70s]
 gi|255507450|ref|ZP_05383089.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis D(s)2923]
 gi|76168103|gb|AAX51111.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis A/HAR-13]
 gi|231273481|emb|CAX10397.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/TZ1A828/OT]
 gi|231274494|emb|CAX11290.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis B/Jali20/OT]
 gi|289525874|emb|CBJ15356.1| ribonucleoside-diphosphate reductase beta chain [Chlamydia
           trachomatis Sweden2]
 gi|296435459|gb|ADH17637.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/150]
 gi|296439176|gb|ADH21329.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydia
           trachomatis E/11023]
          Length = 346

 Score =  172 bits (435), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E QQ+   ++  A  LEI YA
Sbjct: 213 MIGIGEQYQYILRDETIHLNFGIDLINGIKEENPGIWTPELQQEIVELIKRAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y+Q IA+RR  +IGL+P++ +T+NPFPWMSE IDL KEKNFF
Sbjct: 273 QDCLPRGILGLRASMFIDYVQHIADRRLERIGLKPIY-HTKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 332 ETRVIEYQHAASLTW 346


>gi|283779060|ref|YP_003369815.1| ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
 gi|283437513|gb|ADB15955.1| Ribonucleoside-diphosphate reductase [Pirellula staleyi DSM 6068]
          Length = 357

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 100/136 (73%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN ++ ENP +WT +FQ++   ++ EA  LE+AYA
Sbjct: 223 MTGIGEQFQYILRDETIHLNFGIDLINGVRAENPGIWTADFQERVIKLVREAVELEVAYA 282

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G VGLN      Y+Q IA+RR  +IGL P    + NPFPWMSE +DL KEKNFF
Sbjct: 283 WDCLPRGIVGLNGELFRDYVQHIADRRLERIGL-PTQYGSANPFPWMSETMDLGKEKNFF 341

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ  A L WD
Sbjct: 342 ETRVTEYQSAASLAWD 357


>gi|297621807|ref|YP_003709944.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
 gi|297377108|gb|ADI38938.1| ribonucleoside-diphosphate reductase beta subunit [Waddlia
           chondrophila WSU 86-1044]
          Length = 344

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN IK ENP +W ++   +   ++ +A  LEIAYA
Sbjct: 210 MPGIGEQFQYILRDETIHLNFGIDLINGIKAENPEIWNEDLTDEINGLVQQAVELEIAYA 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +GLNA    +Y+Q++A+RR  +IGL  ++K + NPFPWMSE +DL KEKNFF
Sbjct: 270 KECLPHGVLGLNAGLFVEYVQYVADRRLERIGLSAIYK-SSNPFPWMSETMDLTKEKNFF 328

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ  A L WD
Sbjct: 329 ETRVTEYQSAAVLSWD 344


>gi|325110864|ref|YP_004271932.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
 gi|324971132|gb|ADY61910.1| ribonucleotide reductase [Planctomyces brasiliensis DSM 5305]
          Length = 353

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 100/136 (73%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           + GI EQ+QYI+RDE+ HLNFGID+IN IK ENP +WT++FQQ+   ++ EA  LEI YA
Sbjct: 219 LTGIGEQFQYILRDETTHLNFGIDLINGIKHENPDIWTEKFQQEIIDLVKEAVELEIDYA 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GLN      Y+Q IA+RR  +IGL  L+  + NPFPWMSE +DL KEKNFF
Sbjct: 279 RDCLPRGVLGLNGNLFRDYVQHIADRRLERIGLPTLYN-SSNPFPWMSETMDLAKEKNFF 337

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ G  L WD
Sbjct: 338 ETRVTEYQTGGTLSWD 353


>gi|330443801|ref|YP_004376787.1| ribonucleoside-diphosphate reductase subunit beta [Chlamydophila
           pecorum E58]
 gi|328806911|gb|AEB41084.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pecorum E58]
          Length = 346

 Score =  169 bits (427), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +W+KE Q++   ++  A  LEI YA
Sbjct: 213 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWSKELQEEIIALIETAVGLEIDYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +PKG +GL +     Y++ IA+RR  +IGL+P++  ++NPFPWMSE +DL KEKNFF
Sbjct: 273 KDCLPKGILGLKSSMFIDYVRHIADRRLERIGLKPIYN-SKNPFPWMSETMDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ  A L W
Sbjct: 332 ETRVTEYQTAASLSW 346


>gi|189219089|ref|YP_001939730.1| ribonucleotide-diphosphate reductase subunit beta
           [Methylacidiphilum infernorum V4]
 gi|189185947|gb|ACD83132.1| Ribonucleotide reductase, beta subunit [Methylacidiphilum
           infernorum V4]
          Length = 361

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 103/135 (76%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN I+ ENP +WT  FQ++   M+ E+  LE AYA
Sbjct: 228 MTGIGEQFQYILRDETIHLNFGIDLINGIREENPEIWTAGFQKEIEEMIDESVRLEYAYA 287

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GLN+   + Y+++IA+RR  +IG +  +  ++NPFPWMSEV+DL KEKNFF
Sbjct: 288 RDCLPRGILGLNSALFKDYVEYIADRRLERIGFKAKYG-SKNPFPWMSEVMDLVKEKNFF 346

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ GA L W
Sbjct: 347 ETRVTEYQSGAVLNW 361


>gi|29840533|ref|NP_829639.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           caviae GPIC]
 gi|29834882|gb|AAP05517.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           caviae GPIC]
          Length = 346

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +W++E Q +   ++ +A  LEI YA
Sbjct: 213 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWSQELQDEIIALIQKAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL +     Y++ IA+RR  +IGL+P++ Y++NPFPWMSE IDL KEKNFF
Sbjct: 273 KDCLPRGILGLKSSMFIDYVRHIADRRLERIGLKPIY-YSKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ    L W
Sbjct: 332 ETRVTEYQTSGNLSW 346


>gi|62185356|ref|YP_220141.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           abortus S26/3]
 gi|62148423|emb|CAH64191.1| putative ibonucleoside reductase small subunit [Chlamydophila
           abortus S26/3]
          Length = 349

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E Q +   ++ +A  LEI YA
Sbjct: 216 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWTPELQSEIIALIEKAVDLEIEYA 275

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y++ IA+RR  +IGL+P++ +++NPFPWMSE IDL KEKNFF
Sbjct: 276 RDCLPRGILGLKASMFIDYVRHIADRRLERIGLKPIY-HSKNPFPWMSETIDLNKEKNFF 334

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 335 ETRVIEYQTAANLSW 349


>gi|313848275|emb|CBY17276.1| putative ibonucleoside reductase small subunit [Chlamydophila
           psittaci RD1]
          Length = 349

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E Q +   ++ +A  LEI YA
Sbjct: 216 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWTPELQSEIIALIEKAVDLEIEYA 275

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y++ IA+RR  +IGL+P++ +++NPFPWMSE IDL KEKNFF
Sbjct: 276 RDCLPRGILGLKASMFIDYVRHIADRRLERIGLKPIY-HSKNPFPWMSETIDLNKEKNFF 334

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 335 ETRVIEYQTAANLSW 349


>gi|329943118|ref|ZP_08291892.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|325507260|gb|ADZ18898.1| ribonucleotide reductase subunit beta [Chlamydophila psittaci 6BC]
 gi|328814665|gb|EGF84655.1| ribonucleotide reductase, small chain family protein [Chlamydophila
           psittaci Cal10]
 gi|328914953|gb|AEB55786.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           psittaci 6BC]
          Length = 346

 Score =  167 bits (423), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E Q +   ++ +A  LEI YA
Sbjct: 213 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWTPELQSEIIALIEKAVDLEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL A     Y++ IA+RR  +IGL+P++ +++NPFPWMSE IDL KEKNFF
Sbjct: 273 RDCLPRGILGLKASMFIDYVRHIADRRLERIGLKPIY-HSKNPFPWMSETIDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ  A L W
Sbjct: 332 ETRVIEYQTAANLSW 346


>gi|89898045|ref|YP_515155.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           felis Fe/C-56]
 gi|89331417|dbj|BAE81010.1| ribonucleoside-diphosphate reductase beta chain [Chlamydophila
           felis Fe/C-56]
          Length = 349

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 101/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +W+++ Q +   ++ +A  LEI YA
Sbjct: 216 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWSQQLQDEIVDLIQKAVDLEIEYA 275

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL +     Y++ IA+RR  +IGL+P++  ++NPFPWMSE IDL KEKNFF
Sbjct: 276 RDCLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIYN-SKNPFPWMSETIDLNKEKNFF 334

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ  A L W
Sbjct: 335 ETRVTEYQTAANLNW 349


>gi|159899093|ref|YP_001545340.1| ribonucleotide-diphosphate reductase subunit beta [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159892132|gb|ABX05212.1| Ribonucleoside-diphosphate reductase [Herpetosiphon aurantiacus
           ATCC 23779]
          Length = 342

 Score =  166 bits (420), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 76/136 (55%), Positives = 100/136 (73%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           + GI EQ QYI+RDE++HLNFG+D+IN IK ENP +WT EFQ +   ++ ++  LE  YA
Sbjct: 208 LTGIGEQIQYILRDETIHLNFGVDLINGIKAENPAIWTNEFQAEIVQLIRQSVELEAQYA 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P+G +GL+A     Y+Q+IA+RR  +IGL   +  ++NPFPWMSE IDL KEKNFF
Sbjct: 268 AECLPRGVMGLHAAMFRDYVQYIADRRLQRIGLAIQYG-SQNPFPWMSETIDLTKEKNFF 326

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ  A L+WD
Sbjct: 327 ETRVTEYQSAASLEWD 342


>gi|33242353|ref|NP_877294.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae TW-183]
 gi|33236864|gb|AAP98951.1| ribonucleoside reductase small chain [Chlamydophila pneumoniae
           TW-183]
          Length = 365

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 100/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E Q++   ++ +A  LEI YA
Sbjct: 232 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWTTELQEEIVALIEKAVELEIEYA 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL +     Y++ IA+RR  +IGL+P++ ++ NPFPWMSE +DL KEKNFF
Sbjct: 292 KDCLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIY-HSRNPFPWMSETMDLNKEKNFF 350

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ    L W
Sbjct: 351 ETRVTEYQTAGNLSW 365


>gi|15618893|ref|NP_225179.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae CWL029]
 gi|15836516|ref|NP_301040.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae J138]
 gi|16752043|ref|NP_445409.1| ribonucleotide-diphosphate reductase subunit beta [Chlamydophila
           pneumoniae AR39]
 gi|14195165|sp|Q9Z6S4|RIR2_CHLPN RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|4377313|gb|AAD19122.1| Ribonucleoside Reductase, Small Chain [Chlamydophila pneumoniae
           CWL029]
 gi|7189783|gb|AAF38660.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae AR39]
 gi|8979358|dbj|BAA99192.1| ribonucleoside reductase, small chain [Chlamydophila pneumoniae
           J138]
 gi|269302786|gb|ACZ32886.1| ribonucleoside-diphosphate reductase, beta subunit [Chlamydophila
           pneumoniae LPCoLN]
          Length = 346

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 100/135 (74%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQYQYI+RDE++HLNFGID+IN IK ENP +WT E Q++   ++ +A  LEI YA
Sbjct: 213 MTGIGEQYQYILRDETIHLNFGIDLINGIKEENPEVWTTELQEEIVALIEKAVELEIEYA 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+G +GL +     Y++ IA+RR  +IGL+P++ ++ NPFPWMSE +DL KEKNFF
Sbjct: 273 KDCLPRGILGLRSSMFIDYVRHIADRRLERIGLKPIY-HSRNPFPWMSETMDLNKEKNFF 331

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ    L W
Sbjct: 332 ETRVTEYQTAGNLSW 346


>gi|149173739|ref|ZP_01852368.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
 gi|148847269|gb|EDL61603.1| ribonucleotide-diphosphate reductase beta subunit [Planctomyces
           maris DSM 8797]
          Length = 359

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 80/136 (58%), Positives = 95/136 (69%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN IK ENP LWT EFQQ     +  A  LEI YA
Sbjct: 225 MTGIGEQFQYILRDETIHLNFGIDLINGIKQENPDLWTPEFQQLIIDRMKYAAELEIEYA 284

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P G +GLN     +Y+Q IA+RR  +IGL P    + NPFPWMSE +DL KEKNFF
Sbjct: 285 KDCLPTGILGLNGELFREYVQHIADRRLERIGL-PAQYGSANPFPWMSETMDLSKEKNFF 343

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ    L WD
Sbjct: 344 ETRVTEYQSSGSLNWD 359


>gi|269839640|ref|YP_003324332.1| ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269791370|gb|ACZ43510.1| Ribonucleoside-diphosphate reductase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 353

 Score =  163 bits (412), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN IK ENP  WT+E ++    M+ +A   EIAYA
Sbjct: 219 MTGIGEQFQYILRDETVHLNFGIDLINTIKEENPEAWTEELRRDLVGMIRQAVEYEIAYA 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +GLNA    +Y+Q+IA+RR  +I L P+   + NPFPWMSE +DL KEKNFF
Sbjct: 279 RECLPNGVLGLNADLFREYVQYIADRRLERIEL-PVQYRSRNPFPWMSETMDLPKEKNFF 337

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRVTEYQ    L WD
Sbjct: 338 ETRVTEYQNAGTLVWD 353


>gi|300709535|ref|YP_003735349.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
 gi|299123218|gb|ADJ13557.1| ribonucleotide-diphosphate reductase subunit beta [Halalkalicoccus
           jeotgali B3]
          Length = 330

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 97/135 (71%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG+ EQ++YIMRDESLHLNFG+D+IN ++ EN  +WT  F+ +   +L EA  LE  YA
Sbjct: 197 MVGVGEQFEYIMRDESLHLNFGVDLINTVREENSGIWTDVFEAEIEGLLREAVELERTYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E  P+  +G+      +Y++++A+RR  Q+G+EP++  T+NPFPWM+E +DL KEKNFF
Sbjct: 257 REACPEEVLGMGPAQFAEYVEYVADRRLDQLGMEPVYD-TDNPFPWMAEQVDLNKEKNFF 315

Query: 121 ETRVTEYQQGAGLKW 135
           ET V EYQ G  L+W
Sbjct: 316 ETNVAEYQSGGSLEW 330


>gi|313117005|ref|YP_004038129.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
 gi|312294957|gb|ADQ68993.1| ribonucleotide reductase, beta subunit [Halogeometricum borinquense
           DSM 11551]
          Length = 330

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGI +Q++YIMRDESLH+ FG+D+INQI+ ENP  WT EF  + R ++ +A  LE  YA
Sbjct: 197 MVGIGQQFEYIMRDESLHVGFGVDLINQIRAENPDAWTDEFGAEVRDLIEKAVDLEQIYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E  P   +G++     +Y++ +A+RR  Q+ L+  +  T+NPFPWMSE +DL KEKNFF
Sbjct: 257 REACPDDVLGMSPDQFAEYVEHVADRRLGQLDLDASYG-TDNPFPWMSEAVDLNKEKNFF 315

Query: 121 ETRVTEYQQGAGLKW 135
           ET+VTEYQ G  L W
Sbjct: 316 ETQVTEYQSGGSLDW 330


>gi|15791173|ref|NP_280997.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           sp. NRC-1]
 gi|169236929|ref|YP_001690129.1| ribonucleotide-diphosphate reductase subunit beta [Halobacterium
           salinarum R1]
 gi|10581791|gb|AAG20477.1| ribonucleoside reductase small chain [Halobacterium sp. NRC-1]
 gi|167727995|emb|CAP14783.1| ribonucleoside-diphosphate reductase beta subunit [Halobacterium
           salinarum R1]
          Length = 331

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 99/136 (72%), Gaps = 1/136 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG+ EQ++YIMRDESLHLNFG+D+INQI+ E+P +WT +F+ +  +++ +A  LE  YA
Sbjct: 197 MVGVGEQFEYIMRDESLHLNFGVDLINQIRDEHPDVWTADFEAEVNSLMRDAVDLEQLYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +  P   +G+++     Y++++A+RR  Q+ ++P++  T+NPFPWM+E +DL  E NFF
Sbjct: 257 RDACPDDLLGMSSEQFADYVEYVADRRFQQLRMDPVYG-TDNPFPWMTEQVDLNTETNFF 315

Query: 121 ETRVTEYQQGAGLKWD 136
           E  V+EYQQG  L WD
Sbjct: 316 ERNVSEYQQGGSLDWD 331


>gi|257053403|ref|YP_003131236.1| ribonucleotide-diphosphate reductase subunit beta [Halorhabdus
           utahensis DSM 12940]
 gi|256692166|gb|ACV12503.1| Ribonucleoside-diphosphate reductase [Halorhabdus utahensis DSM
           12940]
          Length = 330

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 96/135 (71%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGI +Q++YIMRDESLH+ FG+D+I+QI+ ENP +WT EF  +   ++ EA  LE  YA
Sbjct: 197 MVGIGQQFEYIMRDESLHVGFGVDLIDQIRTENPGVWTDEFDSEVIDLIKEAVELEQIYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E  P+  +G++      Y+++IA+RR  Q+ L   +  TENPFPWMSE +DL KEKNFF
Sbjct: 257 REACPEEILGMSGSQFADYVEYIADRRLDQLDLPEQYG-TENPFPWMSEQVDLNKEKNFF 315

Query: 121 ETRVTEYQQGAGLKW 135
           ET+VTEYQ G  L+W
Sbjct: 316 ETQVTEYQSGGSLEW 330


>gi|322368525|ref|ZP_08043093.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
 gi|320551809|gb|EFW93455.1| ribonucleotide-diphosphate reductase subunit beta [Haladaptatus
           paucihalophilus DX253]
          Length = 330

 Score =  151 bits (382), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGI +Q++YI+RDESLH+ FG+D+IN+I+ ENP+ WT  F  +   ++  A  LE  YA
Sbjct: 197 MVGIGQQFEYILRDESLHVGFGVDLINEIRAENPNAWTDAFGDEVTDLITNAVELEKIYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           +E  P   +G++A    +Y++ IA+RR  Q+ L+  +  TENPFPWMSE +DL KEKNFF
Sbjct: 257 YEACPDEILGMSAAQFAEYVEHIADRRLAQLDLDEQYG-TENPFPWMSEQVDLNKEKNFF 315

Query: 121 ETRVTEYQQGAGLKW 135
           ET+VTEYQ G  L W
Sbjct: 316 ETQVTEYQSGGSLDW 330


>gi|289582310|ref|YP_003480776.1| ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
 gi|289531863|gb|ADD06214.1| Ribonucleoside-diphosphate reductase [Natrialba magadii ATCC 43099]
          Length = 330

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 96/135 (71%), Gaps = 1/135 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVGI +Q++YIMRDESLH+ FG+D+I+QI++ENP +WT  F  +   ++ EA  LE  YA
Sbjct: 197 MVGIGQQFEYIMRDESLHVGFGVDLIDQIRMENPDVWTDAFGDEVVELITEAVELEKIYA 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           +E  P   +G++A    +Y++ IA+RR  Q+ L P    T+NPFPW+SE +DL KEKNFF
Sbjct: 257 YEACPDEILGMSADQFAEYVEHIADRRLGQLDL-PTQYGTDNPFPWLSEQVDLNKEKNFF 315

Query: 121 ETRVTEYQQGAGLKW 135
           ET+VTEYQ G  L W
Sbjct: 316 ETQVTEYQSGGSLDW 330


>gi|330941350|gb|EGH44202.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 109

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 66/109 (60%), Positives = 82/109 (75%)

Query: 28  QIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRR 87
           QIKIENPHLW  E ++++  M+ + T LEI YA +TMP+G +G+NA   E Y++FIANRR
Sbjct: 1   QIKIENPHLWDAEMKEEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRR 60

Query: 88  CHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGAGLKWD 136
             QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G  L WD
Sbjct: 61  LSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD 109


>gi|118500933|gb|ABK97635.1| ribonucleoside diphosphate reductase beta subunit [Allochromatium
           vinosum DSM 180]
          Length = 280

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ+QYI+RDES+H+NFGIDVINQIKIENPHLWT +F+Q+   M+ EA  LE  YA
Sbjct: 189 MTGTAEQFQYILRDESMHMNFGIDVINQIKIENPHLWTPDFRQELVGMIREAVELEARYA 248

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIG 92
           H+TMP+G +GLNA   E Y+ FIANRRC QIG
Sbjct: 249 HDTMPRGVLGLNAQMFEDYLHFIANRRCAQIG 280


>gi|291336894|gb|ADD96423.1| hypothetical protein [uncultured organism MedDCM-OCT-S09-C426]
          Length = 147

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 90/134 (67%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+++Q +Y +RDESLH+NFG  +IN +K + P +WTK+F++++   + +A  LEI YAH+
Sbjct: 13  GLSDQIRYTLRDESLHINFGTYLINTLKEQYPTIWTKKFEEETIEHIKKAVQLEINYAHD 72

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P+G +GLNA     YM +I NRR   IGL+  F+   NPFPW+SEV+D     NFFE 
Sbjct: 73  VLPRGILGLNADMFVDYMHYIGNRRLEGIGLDYRFESDTNPFPWLSEVVDTGAMTNFFER 132

Query: 123 RVTEYQQGAGLKWD 136
           +V +YQ    L+ D
Sbjct: 133 KVKDYQNSGVLEDD 146


>gi|284043177|ref|YP_003393517.1| ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
 gi|283947398|gb|ADB50142.1| Ribonucleoside-diphosphate reductase [Conexibacter woesei DSM
           14684]
          Length = 364

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 86/131 (65%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           GI   ++Y +RDES H+     ++ ++  ENP +WT EF+ + R ++ EA  LE  +  +
Sbjct: 226 GIGTMFRYTLRDESNHIELFRRLLRELVAENPEIWTAEFRDELRELMREAVALEQRFIDD 285

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   VGLNA    QY+ +IA+RR   +GLEPL    ENP PW++E++D++KE+NFFE 
Sbjct: 286 CLPVEGVGLNADEFAQYIDYIADRRLEGVGLEPLKPGVENPLPWLAELMDVRKEQNFFEG 345

Query: 123 RVTEYQQGAGL 133
           RVTEYQ+ + L
Sbjct: 346 RVTEYQKASAL 356


>gi|153875510|ref|ZP_02003277.1| ribonucleotide-diphosphate reductase beta subunit [Beggiatoa sp.
           PS]
 gi|152068026|gb|EDN66723.1| ribonucleotide-diphosphate reductase beta subunit [Beggiatoa sp.
           PS]
          Length = 374

 Score =  123 bits (309), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 86/133 (64%), Gaps = 2/133 (1%)

Query: 5   AEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETM 64
           A+QY YI RDE+LH + G+ +I QI  EN  LW    Q++SR ++ EA  LE  YAH +M
Sbjct: 243 AQQYSYIWRDENLHSSNGLWLIKQIIQENHELWDSTMQERSRAIVSEAVKLETDYAHASM 302

Query: 65  PK-GFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETR 123
           P+ G VGL   +  ++  F+A+  C  +G++PLF+  E+P PW+SE  +L  E NFFE R
Sbjct: 303 PEGGIVGLPVKTYIKFSHFVADNICKNLGIKPLFRVREHPMPWISEY-ELNHEVNFFEGR 361

Query: 124 VTEYQQGAGLKWD 136
           V EYQ G+ L WD
Sbjct: 362 VREYQTGSQLTWD 374


>gi|294055010|ref|YP_003548668.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614343|gb|ADE54498.1| Ribonucleoside-diphosphate reductase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 360

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 87/131 (66%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           GI + ++Y +RDES H+    ++I  +  EN  +WT EF+++ R ++ EA  LE  +  +
Sbjct: 222 GIGQMFRYTLRDESNHIEVFRNLIMDLIEENEDVWTPEFREELRDLMREAVTLEKDFIRD 281

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   VGL+A    QY+ +IA+RR   +GL PL    +NPFPW++E++D+KKE+NFFE 
Sbjct: 282 CLPVNSVGLSADEFCQYIDYIADRRLEGVGLAPLSPGVDNPFPWLAEMMDIKKEQNFFEG 341

Query: 123 RVTEYQQGAGL 133
           RVTEYQ+ + L
Sbjct: 342 RVTEYQKASAL 352


>gi|241589542|ref|YP_002979567.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
 gi|240868254|gb|ACS65913.1| Ribonucleoside-diphosphate reductase [Ralstonia pickettii 12D]
          Length = 328

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQYQYI+RDESLH NFGID+INQIK+ENPHLWT EF+ +   +  +A  LE  YA
Sbjct: 222 MTGAAEQYQYILRDESLHCNFGIDLINQIKLENPHLWTAEFKVEITELFKQAVDLEYRYA 281

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRC 88
            +TMP+G +GLNA   + Y++FI NRRC
Sbjct: 282 EDTMPRGVLGLNASMFKGYLRFICNRRC 309


>gi|254442775|ref|ZP_05056251.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
 gi|198257083|gb|EDY81391.1| ribonucleoside-diphosphate reductase, beta subunit
           [Verrucomicrobiae bacterium DG1235]
          Length = 361

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 82/132 (62%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           GI E ++Y +RDES H+    ++   +  ENP +WT EF+ + R  + EA  LE  +  +
Sbjct: 223 GIGEMFRYTLRDESNHIELLRNLFMDLIEENPDVWTPEFKAELRDAMSEAIALEKEFIAD 282

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +GL      QY+ +IA+RR    GL+PL     NP PW++E++D+KKE+NFFE 
Sbjct: 283 CLPVDSIGLRKEDFVQYIDYIADRRLEGCGLDPLTPGVTNPLPWLAEMMDIKKEQNFFEG 342

Query: 123 RVTEYQQGAGLK 134
           RVTEYQ+ + L+
Sbjct: 343 RVTEYQKASSLE 354


>gi|94986920|ref|YP_594853.1| ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731169|emb|CAJ54531.1| Ribonucleotide reductase, beta subunit [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 333

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQ-IKIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G AEQ+QYI+RDE LH  FGI VI   I+ EN  L     +Q    +  E    EIAY
Sbjct: 201 MKGTAEQFQYILRDEVLHCTFGITVIKGLIEEENITLDPTAVRQ----LWDEVEAAEIAY 256

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           A+  + +  +G NA       +FIANRR  Q+G++  F   +N  PW+ E  +L+KEKNF
Sbjct: 257 ANYILHEPIIGYNADLHIGQFRFIANRRSRQLGMKEPFPGAKNVLPWLDEQSNLRKEKNF 316

Query: 120 FETRVTEYQQGAGLKWD 136
           FETRVTEYQ G GLKWD
Sbjct: 317 FETRVTEYQTGGGLKWD 333


>gi|196233679|ref|ZP_03132520.1| Ribonucleoside-diphosphate reductase [Chthoniobacter flavus
           Ellin428]
 gi|196222349|gb|EDY16878.1| Ribonucleoside-diphosphate reductase [Chthoniobacter flavus
           Ellin428]
          Length = 390

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI + +QY +RDES H+  G  ++ Q+  ENP +WT EF+ +    + E   LE  + 
Sbjct: 249 MTGIGQMFQYTLRDESNHIELGRYILTQLIAENPDIWTPEFRAELVEFMREGVELEKEFV 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P+  VG+       Y+++ A+RR   + L  L     NPF W+ EVI L+KEKNFF
Sbjct: 309 RDCLPEDGVGMTQADFLTYVEYNADRRLAGLDLPALSGVKTNPFAWLDEVIFLRKEKNFF 368

Query: 121 ETRVTEYQQGAGLK 134
           ETRVTEYQ    LK
Sbjct: 369 ETRVTEYQTSGSLK 382


>gi|330949820|gb|EGH50080.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae Cit 7]
          Length = 359

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW  E ++++  M+ + T LEI YA
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLWDAEMKKEATQMILQGTQLEIEYA 339

Query: 61  HETMPKGFVGLNAPSCEQYM 80
            +TMP+G +G+NA   E Y+
Sbjct: 340 RDTMPRGVLGMNAAMMEDYL 359


>gi|254492407|ref|ZP_05105579.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxidans DMS010]
 gi|224462299|gb|EEF78576.1| ribonucleoside-diphosphate reductase, beta subunit [Methylophaga
           thiooxydans DMS010]
          Length = 383

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 78/137 (56%), Gaps = 5/137 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G AEQ QYIMRDE +H +FGI V  QI K EN  L  K+ QQ    M  EA   E  Y
Sbjct: 251 MKGTAEQLQYIMRDEVMHASFGIRVCKQIMKEENITLDPKKVQQ----MFEEADAAEETY 306

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           A   +    +G +        ++ ANRR  Q+G E  F   E   PW+ E  +++KEKNF
Sbjct: 307 AGYILRDPILGYSKEVHHGQFRYTANRRAKQLGFEEPFPGAEATLPWLDEQANMRKEKNF 366

Query: 120 FETRVTEYQQGAGLKWD 136
           FET+VTEYQ G GLKWD
Sbjct: 367 FETKVTEYQTGGGLKWD 383


>gi|90023100|ref|YP_528927.1| amino acid adenylation [Saccharophagus degradans 2-40]
 gi|89952700|gb|ABD82715.1| Class Ia ribonucleoside-diphosphate reductase beta subunit
           [Saccharophagus degradans 2-40]
          Length = 368

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 81/136 (59%), Gaps = 4/136 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ QYIMRDE++H  FGI  ++QI IEN    T       +TM  EA   E  YA
Sbjct: 237 MKGTAEQLQYIMRDETMHCAFGIQTVSQIIIENC---TNIDVDAIKTMWEEADEAEANYA 293

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              + +  +G +A    +  +FIANRR  Q+GLE  F   +   PW+ E  +++KEKNFF
Sbjct: 294 RYILREPILGYSANDHIEQFRFIANRRARQLGLEEPFPQAKCALPWLDEQANIRKEKNFF 353

Query: 121 ETRVTEYQQGAGLKWD 136
           ETRV EYQ G GL+WD
Sbjct: 354 ETRVIEYQAG-GLEWD 368


>gi|149375674|ref|ZP_01893443.1| Ribonucleotide reductase, beta subunit [Marinobacter algicola
           DG893]
 gi|149360076|gb|EDM48531.1| Ribonucleotide reductase, beta subunit [Marinobacter algicola
           DG893]
          Length = 352

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 81/136 (59%), Gaps = 5/136 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G  EQ QYI+RDE++H +FG+ V+NQI + EN  L  K      R M  E+   E AY
Sbjct: 221 MRGTGEQLQYILRDEAMHFSFGLKVVNQILEEENITLDPKAV----RDMWDESEAAETAY 276

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           A+  +    +G +A    +  +F+ANRR   +GLE  F   +N  PW+ E   L+KEKNF
Sbjct: 277 ANYILRDPILGYSAQYHSEQFRFVANRRARTVGLEEPFPGAKNVSPWLDEQATLRKEKNF 336

Query: 120 FETRVTEYQQGAGLKW 135
           FETRV EYQ GA L+W
Sbjct: 337 FETRVIEYQTGAQLEW 352


>gi|225164890|ref|ZP_03727109.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
 gi|224800504|gb|EEG18881.1| Ribonucleoside-diphosphate reductase [Opitutaceae bacterium TAV2]
          Length = 362

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 82/132 (62%), Gaps = 1/132 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           GI + ++Y +RDES H+    +++  +  ENP +WT  F+++ R  + EA  LE  +  +
Sbjct: 223 GIGQMFRYTLRDESNHIEVFRNLLMDLVEENPEIWTPGFKEELRETMREAVTLEKEFIRD 282

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY-TENPFPWMSEVIDLKKEKNFFE 121
            +P   VGL       Y+ +IA+RR   +GL P+     +NP PW++E++D+KKE+NFFE
Sbjct: 283 CLPVNAVGLAVDEFLTYIDYIADRRLEGVGLAPISATPIKNPLPWLAEMMDIKKEQNFFE 342

Query: 122 TRVTEYQQGAGL 133
            RVTEYQ+ + L
Sbjct: 343 GRVTEYQKASSL 354


>gi|87311395|ref|ZP_01093515.1| ribonucleotide-diphosphate reductase beta subunit [Blastopirellula
           marina DSM 3645]
 gi|87285807|gb|EAQ77721.1| ribonucleotide-diphosphate reductase beta subunit [Blastopirellula
           marina DSM 3645]
          Length = 313

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 66/93 (70%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M GI EQ+QYI+RDE++HLNFGID+IN IK ENP LWT EFQ +   ++ +A  LEI YA
Sbjct: 218 MTGIGEQFQYILRDETVHLNFGIDLINGIKAENPDLWTAEFQAEIIDLIKQAVELEIEYA 277

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL 93
            + +P G +GLN      Y+ ++A+RR  +IGL
Sbjct: 278 GDCLPNGILGLNRDLFRDYVHYVADRRVERIGL 310


>gi|311696539|gb|ADP99412.1| ribonucleotide-diphosphate reductase beta subunit [marine bacterium
           HP15]
          Length = 352

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 82/136 (60%), Gaps = 5/136 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS-RTMLHEATLLEIAY 59
           M G  EQ QYI+RDE++H +FG+ V+NQI +E  ++    F  K+ R M  E+   E AY
Sbjct: 221 MRGTGEQLQYILRDEAMHFSFGLKVVNQI-VEEENI---TFDPKAVREMWDESEAAEKAY 276

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           A   +    +G +A    +  +F+ANRR   +GLE  F   +N  PW+ E   L+KEKNF
Sbjct: 277 ADYILRDPILGYSAEYHSEQFRFVANRRARTVGLEEPFPGAKNVSPWLDEQATLRKEKNF 336

Query: 120 FETRVTEYQQGAGLKW 135
           FETRV EYQ GA L+W
Sbjct: 337 FETRVIEYQTGAQLEW 352


>gi|120556760|ref|YP_961111.1| ribonucleoside-diphosphate reductase [Marinobacter aquaeolei VT8]
 gi|120326609|gb|ABM20924.1| Ribonucleoside-diphosphate reductase [Marinobacter aquaeolei VT8]
          Length = 352

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 79/135 (58%), Gaps = 3/135 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  EQ QYI+RDE++H +FG+ V+NQI  E          +  R M  E+   E+AYA
Sbjct: 221 MRGTGEQLQYILRDEAMHFSFGLKVVNQILEEEKITLDP---KAVREMWDESEAAEMAYA 277

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           +  +    +G +A    +  +F+ANRR   +GLE  F   +N  PW+ E   L+KEKNFF
Sbjct: 278 NYVLRDPILGYSAEYHSEQFRFVANRRARTVGLEEPFPGAKNVSPWLDEQATLRKEKNFF 337

Query: 121 ETRVTEYQQGAGLKW 135
           ETRV EYQ GA L+W
Sbjct: 338 ETRVIEYQTGAQLEW 352


>gi|171913278|ref|ZP_02928748.1| ribonucleotide-diphosphate reductase subunit beta [Verrucomicrobium
           spinosum DSM 4136]
          Length = 361

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 51/131 (38%), Positives = 79/131 (60%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           GI   ++Y +RDES H+    ++   +  ENP +WT EF+++   ++ EA  LE  +  +
Sbjct: 223 GIGTMFRYTLRDESNHIKVFRNLFMDLIDENPEIWTPEFREELVELMKEAVALEKEFIRD 282

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   VGL A   E Y+ FIA+RR   +GL  L     NP PW++E+ D++KE+NFFE 
Sbjct: 283 CLPVAAVGLTAGEFELYIDFIADRRLASVGLPALTPGIVNPLPWLAEMQDIRKEQNFFEG 342

Query: 123 RVTEYQQGAGL 133
            VT+YQ+ + L
Sbjct: 343 TVTDYQKASSL 353


>gi|83649535|ref|YP_437970.1| ribonucleotide reductase subunit beta [Hahella chejuensis KCTC
           2396]
 gi|83637578|gb|ABC33545.1| Ribonucleotide reductase, beta subunit [Hahella chejuensis KCTC
           2396]
          Length = 405

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/136 (45%), Positives = 77/136 (56%), Gaps = 5/136 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G  EQ QYIMRDE +H  FGI V+ QI K E   L  K      +T+  EA   E  Y
Sbjct: 274 MKGTGEQLQYIMRDEVMHCAFGIRVVKQIIKEEGVTLDPKAI----KTLWEEAEAAETGY 329

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           AH  + +  +G  A    +  +FIANRR  Q+ L+  F    N  PW+ E   ++KEKNF
Sbjct: 330 AHFLLKEPILGYTAEDHIEQFRFIANRRAKQLKLDEPFPGAGNALPWLDEQASMRKEKNF 389

Query: 120 FETRVTEYQQGAGLKW 135
           FETRVTEYQ GA L+W
Sbjct: 390 FETRVTEYQTGASLQW 405


>gi|88856487|ref|ZP_01131145.1| ribonucleotide-diphosphate reductase beta subunit [marine
           actinobacterium PHSC20C1]
 gi|88814354|gb|EAR24218.1| ribonucleotide-diphosphate reductase beta subunit [marine
           actinobacterium PHSC20C1]
          Length = 332

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 79/124 (63%), Gaps = 1/124 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FGI++I  +  ENP + T+EF  + R M+ +A  +E AY H+ +P G 
Sbjct: 202 DWVVRDESLHLKFGINLILTVLEENPEIQTEEFADEIRQMILDAVEMEEAYNHDLLPGGI 261

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +GLNA    QY++++A+RR  ++G EP +K T NP  WM+   D  +  NFFE+  T Y+
Sbjct: 262 LGLNANYINQYVKYLADRRLEELGFEPHYKVT-NPAKWMATANDTLELVNFFESTNTSYE 320

Query: 129 QGAG 132
             A 
Sbjct: 321 ANAS 324


>gi|254449372|ref|ZP_05062814.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
 gi|198261018|gb|EDY85321.1| ribonucleoside-diphosphate reductase, beta subunit [gamma
           proteobacterium HTCC5015]
          Length = 404

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 59/135 (43%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G AEQ QYIMRDE +H +FG+ V  QI  E      +   +  R M  E    E  YA
Sbjct: 273 MKGTAEQLQYIMRDEVMHASFGLRVARQIMREEN---IQPDPKAMREMWDECEAAEEGYA 329

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +    +G +A       +FIANRR +++ LE  F   EN  PW+ E  +++KEKNFF
Sbjct: 330 RYLLRDPILGYSAEDHVNQFRFIANRRANKLSLEEPFPGAENALPWLDEQANMRKEKNFF 389

Query: 121 ETRVTEYQQGAGLKW 135
           ETRVTEYQ G GL W
Sbjct: 390 ETRVTEYQVGGGLTW 404


>gi|117928932|ref|YP_873483.1| ribonucleoside-diphosphate reductase [Acidothermus cellulolyticus
           11B]
 gi|117649395|gb|ABK53497.1| Ribonucleoside-diphosphate reductase [Acidothermus cellulolyticus
           11B]
          Length = 348

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DVI+ ++ E P L+  E  +++R ML EA   E  +A +
Sbjct: 212 GLASGTNWVFRDESMHMAFAFDVIDTVRREEPELFDDELARQAREMLAEAVDCETQFAED 271

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  G++      Y++ +A+RRC Q+GLEP++  + NPF +M E+ D+++  NFFE 
Sbjct: 272 LLGQGVPGMSLADMRSYLEHVADRRCVQLGLEPIYG-SPNPFTFM-ELQDVQELSNFFER 329

Query: 123 RVTEYQQGAG 132
           RV  YQ G  
Sbjct: 330 RVAAYQIGVS 339


>gi|330467634|ref|YP_004405377.1| ribonucleoside-diphosphate reductase [Verrucosispora maris
           AB-18-032]
 gi|328810605|gb|AEB44777.1| Ribonucleoside-diphosphate reductase [Verrucosispora maris
           AB-18-032]
          Length = 342

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/128 (37%), Positives = 79/128 (61%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV++ ++ E P L+  E +Q+ R ML EA   E+ +A +
Sbjct: 206 GLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDAEMEQQVRDMLAEAVDCEVQFAAD 265

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  G+      QY+Q +A+RR   +G+ P++  T NPF +M E+ D+++  NFFE 
Sbjct: 266 LLEQGVSGMPLADMRQYLQHVADRRLAMLGIAPMYGST-NPFAFM-ELQDVQELSNFFER 323

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 324 RVSAYQVG 331


>gi|238061574|ref|ZP_04606283.1| ribonucleoside-diphosphate reductase [Micromonospora sp. ATCC
           39149]
 gi|237883385|gb|EEP72213.1| ribonucleoside-diphosphate reductase [Micromonospora sp. ATCC
           39149]
          Length = 344

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 79/128 (61%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV++ ++ E P L+  E  ++ R ML EA   E  +A +
Sbjct: 208 GLASGTNWVFRDESMHMAFAFDVVDTVRHEEPDLFDDELARQVREMLAEAVECEAQFAED 267

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  GL+     QY+Q +A+RR  Q+G+ PL+  + NPF +M E+ D+++  NFFE 
Sbjct: 268 LLEQGVSGLSLDDMRQYLQHVADRRLAQLGIAPLYG-SANPFAFM-ELQDVQELSNFFER 325

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 326 RVSAYQVG 333


>gi|126664354|ref|ZP_01735338.1| Ribonucleotide reductase, beta subunit [Marinobacter sp. ELB17]
 gi|126630680|gb|EBA01294.1| Ribonucleotide reductase, beta subunit [Marinobacter sp. ELB17]
          Length = 352

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 81/136 (59%), Gaps = 5/136 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS-RTMLHEATLLEIAY 59
           M G  EQ+QYI+RDE++H +FG+ V+NQI +E  ++    F  K+ R M  E+   E  Y
Sbjct: 221 MRGTGEQFQYILRDEAMHFSFGLKVVNQI-LEEENI---SFDPKAVRDMWDESEAAESDY 276

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
           A+  +    +G +A    +  +F+ANRR   + L   F   +N  PW+ E   ++KEKNF
Sbjct: 277 ANYILRDPILGYSAEYHIEQFRFVANRRARTVNLPEPFPGAKNVSPWLEEQATMRKEKNF 336

Query: 120 FETRVTEYQQGAGLKW 135
           FETRV EYQ GA L+W
Sbjct: 337 FETRVIEYQTGAQLEW 352


>gi|256391238|ref|YP_003112802.1| ribonucleoside-diphosphate reductase [Catenulispora acidiphila DSM
           44928]
 gi|256357464|gb|ACU70961.1| Ribonucleoside-diphosphate reductase [Catenulispora acidiphila DSM
           44928]
          Length = 331

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 77/130 (59%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV++ ++ E P L+ ++  Q+ R ML EA   E  +A +
Sbjct: 195 GLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDEKMAQQVREMLAEAVECETQFAGD 254

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL       Y++ +A+RR  Q+GLEP++  T NP  +M E+ D+++  NFFE 
Sbjct: 255 LLGGGVSGLPVADMRAYLEHVADRRLEQLGLEPMYG-TANPLGFM-ELQDVQELSNFFER 312

Query: 123 RVTEYQQGAG 132
           RV+ YQ   G
Sbjct: 313 RVSAYQVAVG 322


>gi|148273612|ref|YP_001223173.1| ribonucleotide-diphosphate reductase subunit beta [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|170782700|ref|YP_001711034.1| ribonucleotide-diphosphate reductase subunit beta [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|147831542|emb|CAN02508.1| putative ribonucleoside-diphosphate reductase beta subunit
           [Clavibacter michiganensis subsp. michiganensis NCPPB
           382]
 gi|169157270|emb|CAQ02455.1| ribonucleoside-diphosphate reductase beta subunit [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 331

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 76/124 (61%), Gaps = 1/124 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +I+RDESLHL FGI++I  +  ENP L T+EF  + + M+ +A  +E  Y  + +P G 
Sbjct: 203 DWIVRDESLHLKFGINLILTVLEENPDLQTEEFAAEIKQMILDAVEMEEQYNRDLLPNGI 262

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +GLNA    QY++++A+RR  ++G E  +K + NP  WM+   D  +  NFFE+  T Y+
Sbjct: 263 LGLNANYINQYVKYLADRRLEELGFEAEYKVS-NPAKWMATANDTLQLVNFFESTNTSYE 321

Query: 129 QGAG 132
             A 
Sbjct: 322 SNAS 325


>gi|145596896|ref|YP_001161193.1| ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440]
 gi|145306233|gb|ABP56815.1| Ribonucleoside-diphosphate reductase [Salinispora tropica CNB-440]
          Length = 350

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV++ ++ E P L+  + +++ + M+ EA   E+ +A +
Sbjct: 214 GLASGTNWVFRDESMHMAFAFDVVDTVRAEEPDLFDADLERQVKEMVAEAVDCEVQFAED 273

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  GL+     +Y+Q +A+RR   +G+ P++  + NPF +M E+ D+++  NFFE 
Sbjct: 274 LLEQGVSGLSLADMREYLQHVADRRLVTLGIAPMYG-SANPFAFM-ELQDVQELSNFFER 331

Query: 123 RVTEYQQGAG 132
           RV+ YQ G  
Sbjct: 332 RVSAYQMGVS 341


>gi|302867100|ref|YP_003835737.1| ribonucleotide reductase [Micromonospora aurantiaca ATCC 27029]
 gi|315506490|ref|YP_004085377.1| ribonucleotide reductase [Micromonospora sp. L5]
 gi|302569959|gb|ADL46161.1| ribonucleotide reductase [Micromonospora aurantiaca ATCC 27029]
 gi|315413109|gb|ADU11226.1| ribonucleotide reductase [Micromonospora sp. L5]
          Length = 342

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 80/128 (62%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV+  ++ E P L+  E +++ + ML EA   E+++A +
Sbjct: 206 GLASGTNWVFRDESMHMAFAFDVVETVRAEEPDLFDDEMERQVKEMLAEAVECEVSFAED 265

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  G++     +Y+Q +A+RR   +G+ P++  + NPF +M E+ D+++  NFFE 
Sbjct: 266 LLGQGVPGMSLADMREYLQHVADRRLAVLGIAPMYG-SGNPFAFM-ELQDVQELSNFFER 323

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 324 RVSAYQVG 331


>gi|28493649|ref|NP_787810.1| ribonucleotide-diphosphate reductase subunit beta [Tropheryma
           whipplei str. Twist]
 gi|28572842|ref|NP_789622.1| ribonucleotide-diphosphate reductase subunit beta [Tropheryma
           whipplei TW08/27]
 gi|28410975|emb|CAD67360.1| ribonucleotide-diphosphate reductase small chain [Tropheryma
           whipplei TW08/27]
 gi|28476691|gb|AAO44779.1| ribonucleotide reductase beta chain [Tropheryma whipplei str.
           Twist]
          Length = 327

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +I+RDESLHL FGI++I  +  ENP L T +F  + R M+     +E  Y H+ +P G 
Sbjct: 202 DWIVRDESLHLKFGINLILTVLEENPDLQTSDFADEIRGMIIAGVEMEEEYNHDLLPNGI 261

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +GLN+    QY++++A+RR  ++G +P +  T NP  WM+   D  +  NFFE   T Y+
Sbjct: 262 LGLNSGYINQYVKYLADRRLEELGFDPEYNVT-NPAKWMATANDTFELVNFFEAINTSYE 320

Query: 129 QGA 131
             A
Sbjct: 321 SNA 323


>gi|159040364|ref|YP_001539617.1| ribonucleoside-diphosphate reductase [Salinispora arenicola
           CNS-205]
 gi|157919199|gb|ABW00627.1| Ribonucleoside-diphosphate reductase [Salinispora arenicola
           CNS-205]
          Length = 350

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  DV++ I+ E P L+  + +++ + M+ EA   E  +A +
Sbjct: 214 GLASGTNWVFRDESMHMAFAFDVVDTIRAEEPDLFDADLERQIKDMVTEAVDCEAQFAED 273

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  GL+     +Y+Q +A+RR   +G+ P++  ++NPF +M E+ D+++  NFFE 
Sbjct: 274 LLEQGVSGLSLADMREYLQHVADRRLVTLGIAPIYG-SQNPFAFM-ELQDVQELSNFFER 331

Query: 123 RVTEYQQGAG 132
           RV+ YQ G  
Sbjct: 332 RVSAYQVGVS 341


>gi|311743885|ref|ZP_07717691.1| ribonucleotide-diphosphate reductase beta subunit [Aeromicrobium
           marinum DSM 15272]
 gi|311313015|gb|EFQ82926.1| ribonucleotide-diphosphate reductase beta subunit [Aeromicrobium
           marinum DSM 15272]
          Length = 357

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 75/125 (60%), Gaps = 1/125 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +I+RDESLHL FGI++I  +  ENP + T EF  + + M+ +A  +E AY  + +P G 
Sbjct: 233 DWIVRDESLHLKFGINLILTVLEENPEVATAEFAAEIQQMVLDAVEMEEAYNRDLLPGGI 292

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +GLNA    QY++++A+RR  ++G  P +  T NP  WM+   D  +  NFFE   T Y+
Sbjct: 293 LGLNADYINQYVRYLADRRLEELGFGPHYGAT-NPAKWMATANDTLQLVNFFEATNTSYE 351

Query: 129 QGAGL 133
             A L
Sbjct: 352 VNAKL 356


>gi|50955339|ref|YP_062627.1| ribonucleotide-diphosphate reductase subunit beta [Leifsonia xyli
           subsp. xyli str. CTCB07]
 gi|50951821|gb|AAT89522.1| ribonucleoside-diphosphate reductase, beta chain [Leifsonia xyli
           subsp. xyli str. CTCB07]
          Length = 329

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FGI++I  +  ENP L T EF  + + M+ +A  +E  Y  + +P G 
Sbjct: 202 DWVVRDESLHLKFGINLILTVLEENPDLQTPEFAAEIKQMILDAVEMEEQYNRDLLPGGI 261

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +GLNA    QY++++A+RR  ++G E  +K + NP  WM+   D  +  NFFE+  T Y+
Sbjct: 262 LGLNANYINQYVKYLADRRLEELGFEAEYKVS-NPAKWMATANDTLELVNFFESTNTSYE 320

Query: 129 QGA 131
             A
Sbjct: 321 SNA 323


>gi|225873704|ref|YP_002755163.1| ribonucleoside-diphosphate reductase, beta subunit [Acidobacterium
           capsulatum ATCC 51196]
 gi|225791613|gb|ACO31703.1| ribonucleoside-diphosphate reductase, beta subunit [Acidobacterium
           capsulatum ATCC 51196]
          Length = 340

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 73/130 (56%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES HL F  +V+N ++ + P LW  + +     MLHEA   E  +A +
Sbjct: 204 GLASGTNWVFRDESCHLEFAFEVVNVVRSQEPDLWDAQLEADIVEMLHEAVDAETQFAED 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL+     QY+ ++A+ R  ++G+ P F   +NPF +M E+ D+++  NFFE 
Sbjct: 264 LLSGGVAGLSVRDMRQYLGYVADSRLQRLGIAPAFG-VKNPFSFM-ELQDVQELTNFFER 321

Query: 123 RVTEYQQGAG 132
           RV+ YQ    
Sbjct: 322 RVSAYQTAVA 331


>gi|168702494|ref|ZP_02734771.1| ribonucleoside-diphosphate reductase, beta subunit [Gemmata
           obscuriglobus UQM 2246]
          Length = 332

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 76/128 (59%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F   VI+ ++ E P L+  E + +   ML EA   E A+A +
Sbjct: 196 GLATGTNWVFRDESAHMAFAFRVIDTVRREEPDLFDAELEAQIVAMLREAVECETAFARD 255

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            + +G  GL+      Y++++A+RR   +G+ P+F   +NPF +M ++ D+++  NFFE 
Sbjct: 256 VLGQGVAGLSLADLRSYLEYVADRRLESLGIAPVFG-AKNPFGFM-DLQDVQELTNFFER 313

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 314 RVSAYQLG 321


>gi|167948644|ref|ZP_02535718.1| Ribonucleotide reductase, beta subunit [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 124

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 66/127 (51%), Gaps = 3/127 (2%)

Query: 10  YIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFV 69
           YIMRDE LH +FGI V  QI +E          Q  R M  E    E AYA   +    +
Sbjct: 1   YIMRDEVLHASFGIRVAKQIMLEEN---IAPDPQAIREMWDECEAAEDAYAGYILRDPIL 57

Query: 70  GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 129
           G +        +++ANRR  QIGL   +   E   PW+ E  +L+KEKNFFET VTEYQ 
Sbjct: 58  GYSKDDHMGQFRYVANRRARQIGLSEPYPGAEATLPWLDEQANLRKEKNFFETTVTEYQT 117

Query: 130 GAGLKWD 136
           G  L WD
Sbjct: 118 GGALNWD 124


>gi|110802082|ref|YP_699620.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens SM101]
 gi|110682583|gb|ABG85953.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens SM101]
          Length = 344

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL     +I ++K E P ++TKE +++ R M+      EIA+ 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRSIIKELKEEIPEVFTKELKEELREMMRTGVEHEIAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E+Y+++I N R   IGLEPLF+ Y ENP PW+    D  + K +
Sbjct: 266 HYVIGDNVTGINKNLIERYIKYIGNLRAKAIGLEPLFEGYNENPAPWVDYYADANQVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y +   L
Sbjct: 326 FFEAKSTAYAKAGAL 340


>gi|18311342|ref|NP_563276.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens str. 13]
 gi|110801267|ref|YP_697050.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           perfringens ATCC 13124]
 gi|168205189|ref|ZP_02631194.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens E str. JGS1987]
 gi|168210336|ref|ZP_02635961.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens B str. ATCC 3626]
 gi|168213271|ref|ZP_02638896.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens CPE str. F4969]
 gi|168216675|ref|ZP_02642300.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens NCTC 8239]
 gi|169347055|ref|ZP_02865997.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens C str. JGS1495]
 gi|182625797|ref|ZP_02953564.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens D str. JGS1721]
 gi|18146026|dbj|BAB82066.1| ribonucleoside-diphosphate reductase beta subunit [Clostridium
           perfringens str. 13]
 gi|110675914|gb|ABG84901.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens ATCC 13124]
 gi|169296738|gb|EDS78867.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens C str. JGS1495]
 gi|170663363|gb|EDT16046.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens E str. JGS1987]
 gi|170711548|gb|EDT23730.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens B str. ATCC 3626]
 gi|170715235|gb|EDT27417.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens CPE str. F4969]
 gi|177908953|gb|EDT71440.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens D str. JGS1721]
 gi|182381151|gb|EDT78630.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           perfringens NCTC 8239]
          Length = 344

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL     +I ++K E P ++TKE +++ R M+      EIA+ 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRSIIKELKEEIPEVFTKELKEELREMVRTGVEHEIAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E+Y+++I N R   IGLEPLF+ Y ENP PW+    D  + K +
Sbjct: 266 HYVIGDNVTGINKNLIERYIKYIGNLRVKAIGLEPLFEGYNENPAPWVDYYADANQVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y +   L
Sbjct: 326 FFEAKSTAYAKAGAL 340


>gi|148259750|ref|YP_001233877.1| ribonucleotide-diphosphate reductase subunit beta [Acidiphilium
           cryptum JF-5]
 gi|146401431|gb|ABQ29958.1| Ribonucleoside-diphosphate reductase [Acidiphilium cryptum JF-5]
          Length = 338

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 80/142 (56%), Gaps = 10/142 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLHEATLL 55
           M G+ +   + +RDESLH N  I +      ENP +WT+E +++     +  + HE   +
Sbjct: 197 MKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYLCCATIVDHEDAFI 256

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    +     GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW+ E+++  +
Sbjct: 257 DLAFEFGAVE----GLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPWLDEMLNAVE 312

Query: 116 EKNFFETRVTEYQQGAGL-KWD 136
             NFFE R TEY + +    WD
Sbjct: 313 HTNFFENRATEYSKASTAGSWD 334


>gi|326403282|ref|YP_004283363.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
 gi|325050143|dbj|BAJ80481.1| ribonucleoside-diphosphate reductase beta subunit [Acidiphilium
           multivorum AIU301]
          Length = 338

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 80/142 (56%), Gaps = 10/142 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLHEATLL 55
           M G+ +   + +RDESLH N  I +      ENP +WT+E +++     +  + HE   +
Sbjct: 197 MKGMGQIVSWSVRDESLHCNSVIKLFRTFVAENPEIWTEELRREIYLCCATIVDHEDAFI 256

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    +     GL A   ++Y+++IA+RR  Q+GL PLF   +NP PW+ E+++  +
Sbjct: 257 DLAFEFGAVE----GLTAEEVKRYIRYIADRRLLQLGLNPLFHVDKNPLPWLDEMLNAVE 312

Query: 116 EKNFFETRVTEYQQGAGL-KWD 136
             NFFE R TEY + +    WD
Sbjct: 313 HTNFFENRATEYSKASTAGSWD 334


>gi|330949821|gb|EGH50081.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae Cit 7]
          Length = 65

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/65 (64%), Positives = 48/65 (73%)

Query: 72  NAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 131
           N    E Y++FIANRR  QIGL+  +  T NPFPWMSE++DLKKEKNFFETRV EYQ G 
Sbjct: 1   NGAGMEDYLKFIANRRLSQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGG 60

Query: 132 GLKWD 136
            L WD
Sbjct: 61  ALSWD 65


>gi|297157411|gb|ADI07123.1| ribonucleoside-diphosphate reductase [Streptomyces bingchenggensis
           BCW-1]
          Length = 340

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 78/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF   V++ ++ E P L+  E QQ+   ML EA   E+ +A +
Sbjct: 204 GLATGTNWVFRDETMHMNFAFQVVDTVREEEPELFDDELQQQVTDMLREAVEAELQFARD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+ ++++  NFFE 
Sbjct: 264 LCGEGLPGMNTESMRQYLECVADQRLARLGFAPVYG-SENPFSFM-ELQNVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RASAYQ 327


>gi|238023979|ref|YP_002908211.1| Ribonucleotide reductase subunit beta [Burkholderia glumae BGR1]
 gi|237878644|gb|ACR30976.1| Ribonucleotide reductase, beta subunit [Burkholderia glumae BGR1]
          Length = 337

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 79/136 (58%), Gaps = 5/136 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   A+Q+QYIMRDE LH  FGI VI Q+ +E  HL  +      + +  EA   E AYA
Sbjct: 205 MKATAQQFQYIMRDEVLHCGFGIRVIRQL-LEEEHL--RLDPHAVQQIWEEAEAAERAYA 261

Query: 61  HETMPKGFVGLNAP-SCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
              +    +G +A   CEQ+ +FIANRR  Q+ +   F    N  PW+ E  +L+KEKNF
Sbjct: 262 QYILRDPILGYSAELHCEQF-RFIANRRATQLSMPAPFPGATNALPWLDEQANLRKEKNF 320

Query: 120 FETRVTEYQQGAGLKW 135
           FETRVT+YQ G  L W
Sbjct: 321 FETRVTDYQSGGALDW 336


>gi|58584525|ref|YP_198098.1| ribonucleotide-diphosphate reductase subunit beta [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418841|gb|AAW70856.1| Ribonucleotide reductase, beta subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 331

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I++ N    EN  +W  EF++   +       LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTNSIINLFNTFIKENNEIWNDEFKEGLYSACRTIVGLEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y+++IANRR  Q+GL+P++   +NP PW+ E+++  +  NF
Sbjct: 241 KLAFDLGDVEGLSAEEVRNYIRYIANRRLMQLGLKPIYDINDNPLPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|317122809|ref|YP_004102812.1| ribonucleoside-diphosphate reductase [Thermaerobacter marianensis
           DSM 12885]
 gi|315592789|gb|ADU52085.1| Ribonucleoside-diphosphate reductase [Thermaerobacter marianensis
           DSM 12885]
          Length = 336

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 76/129 (58%), Gaps = 1/129 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++++DESLHL+FGI +I  +  E+P L T EF ++ + ++  A  LE  Y   
Sbjct: 205 GLATLVDWVLKDESLHLSFGIHLITTLLEEHPELMTPEFAREVKGLILRAVELERDYNRA 264

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P+  +G++A     Y++++ +RR  ++GL P F  T NP  WM+  +D+ +  NFFE 
Sbjct: 265 LLPRPILGVSADYLNAYIEYVTDRRLDELGLGPHFG-TPNPAQWMATEVDVPEIVNFFEA 323

Query: 123 RVTEYQQGA 131
           R   Y+  A
Sbjct: 324 RNIHYEVAA 332


>gi|88607783|ref|YP_505152.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           phagocytophilum HZ]
 gi|88598846|gb|ABD44316.1| ribonucleoside-diphosphate reductase, beta subunit [Anaplasma
           phagocytophilum HZ]
          Length = 323

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDESLH +  I + N    EN  +W  + +Q+         +LE  + 
Sbjct: 181 MKGMGQIIAWSARDESLHTDSIIRLFNTFVHENGEIWDDDLKQELYDACKVIVMLEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A   ++Y++FIANRR  Q+ LEP++   ENP PW+ E+++  +  NF
Sbjct: 241 DLAFALGDVEGLSACEVKRYIRFIANRRLKQLHLEPIYDVAENPLPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYARAA 312


>gi|314918862|gb|EFS82693.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA1]
 gi|314921071|gb|EFS84902.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA3]
          Length = 328

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEEQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  NFFE   T Y+
Sbjct: 261 LGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVVNFFEATNTSYE 319

Query: 129 QGA 131
             A
Sbjct: 320 VNA 322


>gi|289425969|ref|ZP_06427716.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK187]
 gi|289153512|gb|EFD02226.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK187]
 gi|313763766|gb|EFS35130.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL013PA1]
 gi|313802998|gb|EFS44206.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA2]
 gi|313816916|gb|EFS54630.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL059PA1]
 gi|313829718|gb|EFS67432.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL063PA2]
 gi|313839374|gb|EFS77088.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL086PA1]
 gi|314916474|gb|EFS80305.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA4]
 gi|314932316|gb|EFS96147.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL067PA1]
 gi|314956590|gb|EFT00842.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL027PA1]
 gi|314959472|gb|EFT03574.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA1]
 gi|314964864|gb|EFT08964.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL082PA1]
 gi|314968630|gb|EFT12728.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA1]
 gi|315079174|gb|EFT51177.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL053PA2]
 gi|315100241|gb|EFT72217.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL059PA2]
 gi|315102565|gb|EFT74541.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL046PA1]
 gi|315109517|gb|EFT81493.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL030PA2]
 gi|327455890|gb|EGF02545.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA3]
 gi|327458042|gb|EGF04697.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL083PA2]
 gi|328757204|gb|EGF70820.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA1]
 gi|328757585|gb|EGF71201.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL025PA2]
          Length = 328

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEEQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  NFFE   T Y+
Sbjct: 261 LGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVVNFFEATNTSYE 319

Query: 129 QGA 131
             A
Sbjct: 320 VNA 322


>gi|221633388|ref|YP_002522613.1| ribonucleotide-diphosphate reductase subunit beta [Thermomicrobium
           roseum DSM 5159]
 gi|221156578|gb|ACM05705.1| ribonucleoside-diphosphate reductase, beta subunit [Thermomicrobium
           roseum DSM 5159]
          Length = 328

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 77/133 (57%), Gaps = 2/133 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+     ++++DESLHL+FGI +I  I  E+P + +  F ++ R ++  A  LE AY   
Sbjct: 198 GLCTIVDWVLKDESLHLSFGIHLITTILEEHPEIMSAAFGRQLRELILRAVELEEAYNRA 257

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P+  +GL+A    +Y+++IA+RR  ++GL P+     NP  WM   +D+ +  NFFE 
Sbjct: 258 VLPEPLIGLDADVLNRYVRYIADRRLEELGL-PIAFGEPNPLRWMVAQVDMPEIVNFFEA 316

Query: 123 RVTEYQQGAGLKW 135
           R   Y+ G   +W
Sbjct: 317 RNIHYEVGRA-RW 328


>gi|50843560|ref|YP_056787.1| ribonucleotide-diphosphate reductase subunit beta
           [Propionibacterium acnes KPA171202]
 gi|282854887|ref|ZP_06264221.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J139]
 gi|289427904|ref|ZP_06429608.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J165]
 gi|295131638|ref|YP_003582301.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK137]
 gi|50841162|gb|AAT83829.1| ribonucleoside-diphosphate reductase beta chain [Propionibacterium
           acnes KPA171202]
 gi|282582033|gb|EFB87416.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J139]
 gi|289158787|gb|EFD06987.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes J165]
 gi|291376691|gb|ADE00546.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes SK137]
 gi|313771782|gb|EFS37748.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL074PA1]
 gi|313808408|gb|EFS46875.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL087PA2]
 gi|313810605|gb|EFS48319.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL083PA1]
 gi|313813765|gb|EFS51479.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL025PA1]
 gi|313818171|gb|EFS55885.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL046PA2]
 gi|313821029|gb|EFS58743.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA1]
 gi|313823899|gb|EFS61613.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA2]
 gi|313827161|gb|EFS64875.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL063PA1]
 gi|313831646|gb|EFS69360.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL007PA1]
 gi|313834800|gb|EFS72514.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL056PA1]
 gi|314924366|gb|EFS88197.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL001PA1]
 gi|314927054|gb|EFS90885.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL036PA3]
 gi|314961874|gb|EFT05975.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA2]
 gi|314965892|gb|EFT09991.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL082PA2]
 gi|314974996|gb|EFT19091.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL053PA1]
 gi|314977908|gb|EFT22002.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL045PA1]
 gi|314979603|gb|EFT23697.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL072PA2]
 gi|314981613|gb|EFT25706.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA3]
 gi|314984684|gb|EFT28776.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA1]
 gi|314988338|gb|EFT32429.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA2]
 gi|314990428|gb|EFT34519.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL005PA3]
 gi|315082361|gb|EFT54337.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL078PA1]
 gi|315083809|gb|EFT55785.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL027PA2]
 gi|315087306|gb|EFT59282.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL002PA3]
 gi|315089724|gb|EFT61700.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL072PA1]
 gi|315092253|gb|EFT64229.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA4]
 gi|315094826|gb|EFT66802.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL060PA1]
 gi|315095599|gb|EFT67575.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL038PA1]
 gi|315104692|gb|EFT76668.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL050PA2]
 gi|315107754|gb|EFT79730.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL030PA1]
 gi|327326613|gb|EGE68401.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL096PA3]
 gi|327332877|gb|EGE74609.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL096PA2]
 gi|327335278|gb|EGE76988.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL097PA1]
 gi|327447704|gb|EGE94358.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL043PA2]
 gi|327448579|gb|EGE95233.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL043PA1]
 gi|327449568|gb|EGE96222.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL013PA2]
 gi|328757395|gb|EGF71011.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL020PA1]
 gi|328762002|gb|EGF75508.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL099PA1]
          Length = 328

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEEQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  NFFE   T Y+
Sbjct: 261 LGMNADYVNDYVKYLADRRLEELGFEPEYRVV-NPAKWMATANDTLQVVNFFEATNTSYE 319

Query: 129 QGA 131
             A
Sbjct: 320 VNA 322


>gi|327328671|gb|EGE70431.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL103PA1]
          Length = 328

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEEQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
           +G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  NFFE   T Y+
Sbjct: 261 LGMNADYVNDYVKYLADRRLEELGFEPEYRIV-NPAKWMATANDTLQVVNFFEATNTSYE 319

Query: 129 QGA 131
             A
Sbjct: 320 VNA 322


>gi|29829569|ref|NP_824203.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           avermitilis MA-4680]
 gi|29606677|dbj|BAC70738.1| putative ribonucleoside-diphosphate reductase beta chain
           [Streptomyces avermitilis MA-4680]
          Length = 338

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  +V++ ++ E P L+  E QQ+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMSFAFEVVDTVRKEEPELFDDELQQQVTDMLREAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGDGLPGMNTESMRQYLECVADQRLQRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RASAYQ 325


>gi|42523460|ref|NP_968840.1| ribonucleotide-diphosphate reductase small chain [Bdellovibrio
           bacteriovorus HD100]
 gi|39575666|emb|CAE79833.1| ribonucleotide-diphosphate reductase small chain [Bdellovibrio
           bacteriovorus HD100]
          Length = 336

 Score = 91.3 bits (225), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 77/132 (58%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           + G+A    ++ RDES+H+ F I+V+   + E P L+ ++ +     ML +A   E+ +A
Sbjct: 198 LAGLASGTNWVFRDESMHMAFAIEVVKTARKEEPELFNQQMEDMVVQMLEDAIECEMEFA 257

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
           H+ +  G  GL+A    QY+++ A++R   + + P +   +NPF +M E+ D+++  NFF
Sbjct: 258 HDVLNLGVAGLSAKDMRQYLEYCADQRLESLNIAPRYN-VKNPFIFM-ELQDMQELANFF 315

Query: 121 ETRVTEYQQGAG 132
           E RV+ YQ G  
Sbjct: 316 ERRVSAYQTGVS 327


>gi|329939692|ref|ZP_08288993.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           griseoaurantiacus M045]
 gi|329301262|gb|EGG45157.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           griseoaurantiacus M045]
          Length = 347

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+ +E  ++   ML EA   E+ +A +
Sbjct: 211 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPGLFDEELGRQVTDMLREAVEAELQFARD 270

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY+Q +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 271 LCGDGLPGMNTESMRQYLQCVADQRLVRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 328

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 329 RASAYQ 334


>gi|297202281|ref|ZP_06919678.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sviceus ATCC 29083]
 gi|197710199|gb|EDY54233.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sviceus ATCC 29083]
          Length = 340

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+    QQ+   ML EA   E+ +A +
Sbjct: 204 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDRLQQQVTDMLAEAVEAELQFARD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 264 LCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RPSAYQ 327


>gi|91763118|ref|ZP_01265082.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717531|gb|EAS84182.1| ribonucleotide-diphosphate reductase beta subunit [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 342

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 77/136 (56%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ----QKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I +  +   ENP +WT E +    +  RT++ HE   +
Sbjct: 201 MKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFI 260

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M     GL A   + Y++FIANRR  Q+GLEP++   +NP  W+  +++  +
Sbjct: 261 DLAFEMGPMQ----GLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWLDSMLNAVE 316

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 317 HMNFFEGRSTEYSKAA 332


>gi|71083845|ref|YP_266565.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062958|gb|AAZ21961.1| ribonucleoside-diphosphate reductase beta chain [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 337

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 77/136 (56%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ----QKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I +  +   ENP +WT E +    +  RT++ HE   +
Sbjct: 196 MKGMGQIVTWSVRDETLHCNSMIRLFKEFIHENPEIWTPELKAELYKACRTIIEHEDAFI 255

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M     GL A   + Y++FIANRR  Q+GLEP++   +NP  W+  +++  +
Sbjct: 256 DLAFEMGPMQ----GLTAQDVKLYIRFIANRRLSQLGLEPIYDVDKNPLTWLDSMLNAVE 311

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 312 HMNFFEGRSTEYSKAA 327


>gi|294631326|ref|ZP_06709886.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. e14]
 gi|292834659|gb|EFF93008.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. e14]
          Length = 339

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + +Q+   ML EA   E+ +A +
Sbjct: 203 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPDLFDDQLEQQVTDMLREAVEAELQFARD 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 263 LCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 320

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 321 RPSAYQ 326


>gi|254455551|ref|ZP_05068980.1| ribonucleoside-diphosphate reductase, beta subunit [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082553|gb|EDZ59979.1| ribonucleoside-diphosphate reductase, beta subunit [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 335

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT----KEFQQKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I +  +   ENP +WT    KE  +  RT++ HE   +
Sbjct: 194 MKGMGQIVTWSVRDETLHCNSMIRIFKEFINENPEIWTPKLKKELYEACRTIIAHEDAFI 253

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M     GL A   + Y++FI NRR  Q+GLEP++   +NP  W+  +++  +
Sbjct: 254 DLAFEMGPME----GLTAQEVKDYIRFIGNRRLTQLGLEPIYDVDKNPLGWLDTMLNAVE 309

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 310 HMNFFEGRATEYSKAS 325


>gi|190570498|ref|YP_001974856.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019257|ref|ZP_03335064.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190356770|emb|CAQ54129.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995366|gb|EEB56007.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 329

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I++ N    EN  +W  EF+++  +       LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTNSIINLFNTFIKENNEIWNDEFKEELYSACRTIVELEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y+++IANRR  Q+GL+ ++   +NP PW+ E+++  +  NF
Sbjct: 241 SLAFDLGDVEGLSAEEVRNYIRYIANRRLTQLGLKSIYNVKDNPIPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|313903043|ref|ZP_07836438.1| Ribonucleoside-diphosphate reductase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313466767|gb|EFR62286.1| Ribonucleoside-diphosphate reductase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 336

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 75/129 (58%), Gaps = 1/129 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++++DESLHL+FGI +I  +  E+P L T  F ++ + ++  A  LE  Y   
Sbjct: 205 GLATLVDWVLKDESLHLSFGIHLITALLEEHPELMTPAFAREVKGLILRAVELERDYNRA 264

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P+  +G++A     Y++++ +RR  ++GL P F  T NP  WM+  +D+ +  NFFE 
Sbjct: 265 LLPRPILGVSADYLNAYVEYVTDRRLDELGLGPHFG-TPNPAKWMATEVDVPEIVNFFEA 323

Query: 123 RVTEYQQGA 131
           R   Y+  A
Sbjct: 324 RNIHYEVAA 332


>gi|313793687|gb|EFS41718.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL110PA1]
 gi|327456018|gb|EGF02673.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL092PA1]
          Length = 328

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 71/123 (57%), Gaps = 1/123 (0%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPEIATDEFAAEIHDMIVQGVEMEEQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
            G+NA     Y++++A+RR  ++G EP ++   NP  WM+   D  +  NFFE   T Y+
Sbjct: 261 RGMNADYVNDYVKYLADRRLEELGFEPEYR-VANPAKWMATANDTLQVVNFFEATNTSYE 319

Query: 129 QGA 131
             A
Sbjct: 320 VNA 322


>gi|302554045|ref|ZP_07306387.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           viridochromogenes DSM 40736]
 gi|302471663|gb|EFL34756.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           viridochromogenes DSM 40736]
          Length = 341

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + +Q+   ML EA   E+ +A +
Sbjct: 205 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLRQEVTDMLREAVEAELQFARD 264

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 265 LCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 322

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 323 RPSAYQ 328


>gi|239982206|ref|ZP_04704730.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           albus J1074]
 gi|291454052|ref|ZP_06593442.1| ribonucleotide-diphosphate reductase subunit small [Streptomyces
           albus J1074]
 gi|291357001|gb|EFE83903.1| ribonucleotide-diphosphate reductase subunit small [Streptomyces
           albus J1074]
          Length = 350

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 78/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + Q++   ML EA   E+ +A +
Sbjct: 214 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLQEQVVAMLKEAVEAELQFARD 273

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 274 LCGDGLPGMNTESMREYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 331

Query: 123 RVTEYQ 128
           RV+ YQ
Sbjct: 332 RVSAYQ 337


>gi|58700135|ref|ZP_00374651.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58533347|gb|EAL57830.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 225

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  + 
Sbjct: 93  MKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFKEELYSACRTIVELEDEFI 152

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y++++ANRR  Q+GLE ++   +NP PW+ E+++  +  NF
Sbjct: 153 KLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVNDNPIPWLDEILNGVEHTNF 212

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 213 FENRVTEYSRAA 224


>gi|307328555|ref|ZP_07607729.1| Ribonucleoside-diphosphate reductase [Streptomyces violaceusniger
           Tu 4113]
 gi|306885823|gb|EFN16835.1| Ribonucleoside-diphosphate reductase [Streptomyces violaceusniger
           Tu 4113]
          Length = 340

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F   V++ ++ E P L+  E +Q+   ML EA   E+ +A +
Sbjct: 204 GLATGTNWVFRDESMHMEFAFSVVDTVREEEPDLFDDELRQQVTDMLKEAVEAELQFARD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S ++Y+Q +A++R  ++G   +F  +ENPF +M E+ ++++  NFFE 
Sbjct: 264 LCGDGLPGMNTASMQEYLQCVADQRLMRLGFPAVFG-SENPFSFM-ELQNVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RASAYQ 327


>gi|88861512|ref|ZP_01136127.1| ribonucleotide-diphosphate reductase beta subunit
           [Pseudoalteromonas tunicata D2]
 gi|88816487|gb|EAR26327.1| ribonucleotide-diphosphate reductase beta subunit
           [Pseudoalteromonas tunicata D2]
          Length = 219

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT----KEFQQKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I +  +   ENP +WT    KE  +  R ++ HE   +
Sbjct: 78  MKGMGQIVTWSVRDETLHCNSMIRIFKEFIKENPEIWTPTLKKELYEACRIIVEHEDAFI 137

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M     GL A   + Y++FIANRR  Q+GLEP++   +NP  W+  +++  +
Sbjct: 138 DLAFEMGPME----GLTAQEVKDYIRFIANRRLIQLGLEPIYDVQKNPLTWLDTMLNAVE 193

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 194 HMNFFEGRATEYSKAS 209


>gi|239947951|ref|ZP_04699704.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922227|gb|EER22251.1| ribonucleoside-diphosphate reductase, beta subunit [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 327

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 77/136 (56%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +     IENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVIENPEVWTETLRKRIYEACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRATEYSKAA 309


>gi|42520108|ref|NP_966023.1| ribonucleotide-diphosphate reductase subunit beta [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|58696705|ref|ZP_00372253.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|58698234|ref|ZP_00373154.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630036|ref|YP_002726827.1| ribonucleotide-diphosphate reductase beta subunit [Wolbachia sp.
           wRi]
 gi|42409845|gb|AAS13957.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|58535261|gb|EAL59340.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58537117|gb|EAL60231.1| ribonucleoside-diphosphate reductase, beta subunit [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592017|gb|ACN95036.1| ribonucleotide-diphosphate reductase beta subunit [Wolbachia sp.
           wRi]
          Length = 329

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFKEELYSACRTIVELEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y++++ANRR  Q+GLE ++   +NP PW+ E+++  +  NF
Sbjct: 241 KLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVNDNPIPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|302542646|ref|ZP_07294988.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302460264|gb|EFL23357.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           himastatinicus ATCC 53653]
          Length = 343

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F   V++ ++ E P L+  + +++   ML EA   E+ +AH+
Sbjct: 207 GLATGTNWVFRDESMHMEFAFSVVDTVREEEPDLFDDDLERQVTDMLKEAVEAELQFAHD 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S   Y++ +A++R  ++G   +F  +ENPF +M E+ D+++  NFFE 
Sbjct: 267 LCGDGLPGMNTESMRAYLECVADQRLARLGFPAVFG-SENPFSFM-ELQDVQELTNFFER 324

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 325 RASAYQ 330


>gi|256825983|ref|YP_003149943.1| ribonucleotide reductase subunit beta [Kytococcus sedentarius DSM
           20547]
 gi|256689376|gb|ACV07178.1| ribonucleotide reductase, beta subunit [Kytococcus sedentarius DSM
           20547]
          Length = 365

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H+ F  +V+  ++ E P L+  E   + R ML EA   E  +A +
Sbjct: 229 GLASGTNWVFRDESMHMAFAFEVVETVRSEEPDLFDAEMAGQVRQMLMEAVDAEAQFAED 288

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL+      Y++ +A+RR  Q+G+  ++  T+NP  +M E+ D+++  NFFE 
Sbjct: 289 LLGMGVAGLSVADMRAYLENVADRRAVQLGMPEIYG-TKNPLAFM-ELQDVQELSNFFER 346

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 347 RVSAYQVG 354


>gi|302558498|ref|ZP_07310840.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           griseoflavus Tu4000]
 gi|302476116|gb|EFL39209.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           griseoflavus Tu4000]
          Length = 341

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+ ++  Q+   ML EA   E+ +A +
Sbjct: 205 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDEQLGQQVTAMLREAVEAELQFARD 264

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 265 LCGDGLPGMNTESMRQYLECVADQRLVRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 322

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 323 RPSAYQ 328


>gi|258542157|ref|YP_003187590.1| ribonucleotide-diphosphate reductase subunit beta [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633235|dbj|BAH99210.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636294|dbj|BAI02263.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639347|dbj|BAI05309.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642403|dbj|BAI08358.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645458|dbj|BAI11406.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648511|dbj|BAI14452.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651564|dbj|BAI17498.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654555|dbj|BAI20482.1| ribonucleotide-diphosphate reductase beta subunit [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 339

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 77/134 (57%), Gaps = 9/134 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTML-HEATLLEI 57
           G+ +   + +RDE+LH    I +      ENP LWT++ + +     RT++ HE   +++
Sbjct: 195 GMGQIVSWSVRDETLHCLSIIRLFRVFIQENPELWTEQLRTELTDICRTIVEHEEAFIDL 254

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
           A+    +     GLNA   + Y+ FIA+RR  Q+GLEP++  T NP PW+ ++++  +  
Sbjct: 255 AFEMGAVE----GLNAEQVKTYIHFIADRRLTQLGLEPIYNTTTNPLPWLDDMLNAVEHT 310

Query: 118 NFFETRVTEYQQGA 131
           NFFE R TEY + +
Sbjct: 311 NFFENRATEYSRAS 324


>gi|254388985|ref|ZP_05004216.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           clavuligerus ATCC 27064]
 gi|294814921|ref|ZP_06773564.1| Ribonucleoside-diphosphate reductase beta chain protein
           [Streptomyces clavuligerus ATCC 27064]
 gi|326443293|ref|ZP_08218027.1| Ribonucleoside-diphosphate reductase [Streptomyces clavuligerus
           ATCC 27064]
 gi|197702703|gb|EDY48515.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           clavuligerus ATCC 27064]
 gi|218078699|emb|CAB90708.3| class Ia ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces clavuligerus ATCC 27064]
 gi|294327520|gb|EFG09163.1| Ribonucleoside-diphosphate reductase beta chain protein
           [Streptomyces clavuligerus ATCC 27064]
          Length = 339

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ ++ +
Sbjct: 203 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKEAVEAELQFSRD 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 263 LCGDGLPGMNTESMREYLQCVADQRLARLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 320

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 321 RPSAYQ 326


>gi|21223593|ref|NP_629372.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           coelicolor A3(2)]
 gi|7328345|emb|CAB82486.1| class I ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces coelicolor A3(2)]
 gi|8546891|emb|CAB94610.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           coelicolor A3(2)]
          Length = 343

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + +++   ML EA   E+ +A +
Sbjct: 207 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLREQVTDMLREAVEAELQFARD 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 267 LCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 324

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 325 RPSAYQ 330


>gi|256785295|ref|ZP_05523726.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           lividans TK24]
 gi|289769189|ref|ZP_06528567.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           lividans TK24]
 gi|289699388|gb|EFD66817.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           lividans TK24]
          Length = 343

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + +++   ML EA   E+ +A +
Sbjct: 207 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDQLREQVTDMLREAVEAELQFARD 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 267 LCGDGLPGMNTDSMRQYLECVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 324

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 325 RPSAYQ 330


>gi|99036000|ref|ZP_01315041.1| hypothetical protein Wendoof_01000112 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 329

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDNEFKEELYSACRTIVELEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y++++ANRR  Q+GLE ++   +NP PW+ E+++  +  NF
Sbjct: 241 KLAFDLGDVEGLSAEEVRNYIRYVANRRLMQLGLESIYDVNDNPTPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|329113329|ref|ZP_08242110.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
 gi|326697154|gb|EGE48814.1| Ribonucleoside-diphosphate reductase subunit beta [Acetobacter
           pomorum DM001]
          Length = 339

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 77/134 (57%), Gaps = 9/134 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTML-HEATLLEI 57
           G+ +   + +RDE+LH    I +      ENP LWT++ + +     RT++ HE   +++
Sbjct: 195 GMGQIVSWSVRDETLHCLSIIRLFRVFIQENPELWTEQLRTELTDICRTIVEHEEAFIDL 254

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
           A+    +     GLNA   + Y+ FIA+RR  Q+GLEP++  T NP PW+ ++++  +  
Sbjct: 255 AFEMGAVE----GLNAEQVKTYIHFIADRRLTQLGLEPIYNTTTNPLPWLDDMLNAVEHT 310

Query: 118 NFFETRVTEYQQGA 131
           NFFE R TEY + +
Sbjct: 311 NFFENRSTEYSRAS 324


>gi|225677302|ref|ZP_03788281.1| ribonucleotide-diphosphate reductase beta [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
 gi|225590665|gb|EEH11913.1| ribonucleotide-diphosphate reductase beta [Wolbachia endosymbiont
           of Muscidifurax uniraptor]
          Length = 329

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH N  I + N    EN  +W  EF+++  +       LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTNSIIMLFNTFIKENNEIWDDEFKEELYSACRTIVELEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A     Y+ ++ANRR  Q+GLE ++   +NP PW+ E+++  +  NF
Sbjct: 241 KLAFDFGDVEGLSAEEVRNYIHYVANRRLMQLGLESIYDVNDNPIPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|297192180|ref|ZP_06909578.1| ribonucleoside-diphosphate reductase subunit beta protein
           [Streptomyces pristinaespiralis ATCC 25486]
 gi|197720175|gb|EDY64083.1| ribonucleoside-diphosphate reductase subunit beta protein
           [Streptomyces pristinaespiralis ATCC 25486]
          Length = 340

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+  E +Q+   ML EA   E+ +  +
Sbjct: 204 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDELRQQVTDMLKEAVEAELQFGRD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  +Y+Q +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 264 LCGEGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RPSAYQ 327


>gi|295836584|ref|ZP_06823517.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB74]
 gi|197697282|gb|EDY44215.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB74]
          Length = 345

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  E +Q+ + ML  A   E+ +A +
Sbjct: 209 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDAELEQEVKDMLDGAVNAELQFARD 268

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+  +++  NFFE 
Sbjct: 269 LCGDGLPGMNTESMREYLQCVADQRLQRLGFAPVYG-SSNPFSFM-ELQGVQELTNFFER 326

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 327 RPSAYQ 332


>gi|328884923|emb|CCA58162.1| Ribonucleotide reductase of class Ia (aerobic),beta subunit
           [Streptomyces venezuelae ATCC 10712]
          Length = 338

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    +Q+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALRQQVTDMLKEAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGDGLPGMNTESMREYLQCVADQRLQRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RPSAYQ 325


>gi|209966751|ref|YP_002299666.1| ribonucleotide-diphosphate reductase subunit beta [Rhodospirillum
           centenum SW]
 gi|209960217|gb|ACJ00854.1| ribonucleoside-diphosphate reductase, beta subunit [Rhodospirillum
           centenum SW]
          Length = 322

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 82/142 (57%), Gaps = 10/142 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH    I +      ENP +WT+ FQ++      T++H E   +
Sbjct: 180 MKGMGQIVTWSVRDETLHTLSMIKLFRTFVNENPQVWTEAFQRELTVCCETIVHHEDAFI 239

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+  E  P    G+ A   ++Y+++IA+RR  Q+GLEP+++  +NP PWM  +++  +
Sbjct: 240 DLAF--EMGPVE--GMTAEDVKRYIRWIADRRLGQLGLEPVYRIEKNPLPWMDAILNGIE 295

Query: 116 EKNFFETRVTEYQQGAGL-KWD 136
             NFFE R TEY + A    WD
Sbjct: 296 HTNFFENRATEYSKAATRGTWD 317


>gi|313836278|gb|EFS73992.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA2]
 gi|314928743|gb|EFS92574.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL044PA1]
 gi|314971220|gb|EFT15318.1| ribonucleoside-diphosphate reductase, beta subunit
           [Propionibacterium acnes HL037PA3]
 gi|328906508|gb|EGG26283.1| ribonucleotide-diphosphate reductase subunit beta
           [Propionibacterium sp. P08]
          Length = 324

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 73/123 (59%), Gaps = 5/123 (4%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGF 68
            +++RDESLHL FG+++I  +  ENP + T EF  +   M+ +   +E  Y  + +P+G 
Sbjct: 201 DWVVRDESLHLKFGMNLILTVLEENPDIATDEFAVEIHDMILKGVEMEAQYNRDMLPRGI 260

Query: 69  VGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQ 128
            G+NA     Y++++A+RR  ++GLEP + +  NP  WM+   D  +  NFFET  T Y+
Sbjct: 261 PGMNA----DYVKYLADRRLEELGLEPEY-HVANPAKWMATANDTLQLVNFFETTNTSYE 315

Query: 129 QGA 131
             A
Sbjct: 316 VNA 318


>gi|239944172|ref|ZP_04696109.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces roseosporus NRRL 15998]
 gi|239990628|ref|ZP_04711292.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces roseosporus NRRL 11379]
 gi|291447643|ref|ZP_06587033.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           roseosporus NRRL 15998]
 gi|291350590|gb|EFE77494.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           roseosporus NRRL 15998]
          Length = 338

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+  E QQ+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPDLFDDELQQQVTDMLKEAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  QY++ +A++R  ++G  P    +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGEGLPGMNTESMRQYLECVADQRLARLGF-PTVYGSENPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RPSAYQ 325


>gi|330994651|ref|ZP_08318574.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
 gi|329758292|gb|EGG74813.1| putative ribonucleoside-diphosphate reductase small subunit
           [Gluconacetobacter sp. SXCC-1]
          Length = 365

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 73/136 (53%), Gaps = 2/136 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+ +   + +RDESLH +    +      ENP +WT   +   R +  +    E A+   
Sbjct: 225 GMGQIVSWSVRDESLHCDSMARLFRVFVQENPEIWTDTLRDDIRQICRDIVEHEDAFIDL 284

Query: 63  TMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFE 121
           +   G V GL+A   ++Y++F+ANRR  Q+GL+ ++    NP PW+ E+++  +  NFFE
Sbjct: 285 SFEMGAVEGLDAGQVKRYIRFVANRRLGQLGLDGIYDIATNPLPWVDEMVNAVEHANFFE 344

Query: 122 TRVTEYQQGAGL-KWD 136
            R TEY + +    WD
Sbjct: 345 NRATEYSRASTTGTWD 360


>gi|296116311|ref|ZP_06834927.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977130|gb|EFG83892.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 334

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+ +   + +RDE+LH      +      ENP +WT++ Q   R +  +    E A+   
Sbjct: 195 GMGQIVSWSVRDETLHCVSMARLFRVFVQENPEIWTQKLQDDIRQICRDIVEHEDAFIDL 254

Query: 63  TMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFE 121
           +   G V GL+A   ++Y++F+ANRR  Q+GL+ L+    NP PW+ E+++  +  NFFE
Sbjct: 255 SFEMGPVEGLDAAQVKRYIRFVANRRLGQLGLDGLYDVATNPLPWVDEMVNAVEHANFFE 314

Query: 122 TRVTEYQQGA 131
            R TEY + A
Sbjct: 315 NRSTEYSRAA 324


>gi|291437353|ref|ZP_06576743.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           ghanaensis ATCC 14672]
 gi|291340248|gb|EFE67204.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           ghanaensis ATCC 14672]
          Length = 340

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+ +   Q+   ML EA   E+ +A +
Sbjct: 204 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDERLGQQVTDMLREAVEAELQFARD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 264 LCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RPSAYQ 327


>gi|239929012|ref|ZP_04685965.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces
           ghanaensis ATCC 14672]
          Length = 339

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+ +   Q+   ML EA   E+ +A +
Sbjct: 203 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDERLGQQVTDMLREAVEAELQFARD 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 263 LCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 320

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 321 RPSAYQ 326


>gi|320107274|ref|YP_004182864.1| Ribonucleoside-diphosphate reductase [Terriglobus saanensis SP1PR4]
 gi|319925795|gb|ADV82870.1| Ribonucleoside-diphosphate reductase [Terriglobus saanensis SP1PR4]
          Length = 346

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 72/129 (55%), Gaps = 2/129 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES HL F  +V+  ++ + P LW  E +++   M+ EA   E  +A +
Sbjct: 210 GLASGTNWVFRDESAHLEFAFEVVQVVRAQEPDLWDTELERQVVVMMEEAIDAEAQFAED 269

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL+     QY+ ++A+ R  ++G+   F   +NPF +M E+ D+++  NFFE 
Sbjct: 270 LLSGGVAGLSVRDMRQYLGYVADSRLERLGIGAHFN-AKNPFSFM-ELQDVQELTNFFER 327

Query: 123 RVTEYQQGA 131
           RV+ YQ   
Sbjct: 328 RVSAYQTAV 336


>gi|282861024|ref|ZP_06270089.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. ACTE]
 gi|282563682|gb|EFB69219.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. ACTE]
          Length = 340

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ +  +
Sbjct: 204 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLREAVEAELQFGRD 263

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  QY++ +A++R  ++G   L+  +ENPF +M E+  +++  NFFE 
Sbjct: 264 LCGEGLPGMNTESMRQYLECVADQRLTRLGFPALYG-SENPFSFM-ELQGVQELTNFFER 321

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 322 RPSAYQ 327


>gi|115378653|ref|ZP_01465803.1| ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
 gi|115364319|gb|EAU63404.1| ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
          Length = 288

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 2/131 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  + I   + E P L+    Q     M+ EA   E  +A +
Sbjct: 148 GLAAGTNWVFRDESTHMAFAFEAIRVARQEEPDLFDARMQADVVAMMREAVECETLFAQD 207

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL+     QY++++A++R   +GL P+F+  +N  P+M ++ D+++  NFFE 
Sbjct: 208 LLSGGVAGLSVQEMRQYLEYVADQRLTMLGLAPVFR-VKNSLPFM-DLQDVQELTNFFER 265

Query: 123 RVTEYQQGAGL 133
           RV+ YQ   G+
Sbjct: 266 RVSAYQVAVGV 276


>gi|310823070|ref|YP_003955428.1| ribonucleoside-diphosphate reductase subunit beta [Stigmatella
           aurantiaca DW4/3-1]
 gi|309396142|gb|ADO73601.1| Ribonucleoside-diphosphate reductase, beta subunit [Stigmatella
           aurantiaca DW4/3-1]
          Length = 336

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 2/131 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  + I   + E P L+    Q     M+ EA   E  +A +
Sbjct: 196 GLAAGTNWVFRDESTHMAFAFEAIRVARQEEPDLFDARMQADVVAMMREAVECETLFAQD 255

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL+     QY++++A++R   +GL P+F+  +N  P+M ++ D+++  NFFE 
Sbjct: 256 LLSGGVAGLSVQEMRQYLEYVADQRLTMLGLAPVFR-VKNSLPFM-DLQDVQELTNFFER 313

Query: 123 RVTEYQQGAGL 133
           RV+ YQ   G+
Sbjct: 314 RVSAYQVAVGV 324


>gi|320008647|gb|ADW03497.1| Ribonucleoside-diphosphate reductase [Streptomyces flavogriseus
           ATCC 33331]
          Length = 338

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+  E +Q+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPDLFDDELRQQVTDMLKEAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G   L+  +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGDGLPGMNTESMRQYLECVADQRLTRLGFPALYG-SENPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RPSAYQ 325


>gi|328950373|ref|YP_004367708.1| Ribonucleoside-diphosphate reductase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450697|gb|AEB11598.1| Ribonucleoside-diphosphate reductase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 332

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 1/128 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+     + ++DESLHL+FG+ +I     E   + T    ++ R ++ EA  LE AY   
Sbjct: 202 GLGAIIDWTLKDESLHLSFGLHLITGFLEEYSEVMTPRLAREVRGLILEAVQLERAYNQA 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P+  +GL+A +   Y++++A+RR  ++GLE  F  T NP  WM+  +D+ +  NFFE 
Sbjct: 262 LLPRPILGLSAETLNAYVEYVADRRLEELGLEAAFG-TPNPAKWMATEVDVPEIVNFFEA 320

Query: 123 RVTEYQQG 130
             T Y+ G
Sbjct: 321 VNTSYEVG 328


>gi|157825769|ref|YP_001493489.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia akari
           str. Hartford]
 gi|157799727|gb|ABV74981.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia akari
           str. Hartford]
          Length = 327

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQIISWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRATEYSKAA 309


>gi|157803769|ref|YP_001492318.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           canadensis str. McKiel]
 gi|157785032|gb|ABV73533.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           canadensis str. McKiel]
          Length = 324

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQVIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYGACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRATEYSKAA 309


>gi|187932511|ref|YP_001884520.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           botulinum B str. Eklund 17B]
 gi|187720664|gb|ACD21885.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B str. Eklund 17B]
          Length = 344

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ ENP  +T + + + R M+H     EI + 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIIKELQSENPESFTADLKNELREMMHIGVENEILWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E Y++++ N+R  +IGLEPLF  Y ENP  W+  V +    K +
Sbjct: 266 HYVIGDKIQGINKKLIEDYIKYLGNKRLKEIGLEPLFSGYEENPATWVDVVANSNSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y + + L
Sbjct: 326 FFEAKSTAYAKVSTL 340


>gi|157964544|ref|YP_001499368.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           massiliae MTU5]
 gi|157844320|gb|ABV84821.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia
           massiliae MTU5]
          Length = 336

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 179 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 238

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 239 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 294

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 295 HTNFFENRATEYSKAA 310


>gi|15892574|ref|NP_360288.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           conorii str. Malish 7]
 gi|34580440|ref|ZP_00141920.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           sibirica 246]
 gi|157828524|ref|YP_001494766.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933242|ref|YP_001650031.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. Iowa]
 gi|229586746|ref|YP_002845247.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           africae ESF-5]
 gi|238650260|ref|YP_002916112.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           peacockii str. Rustic]
 gi|15619738|gb|AAL03189.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia conorii
           str. Malish 7]
 gi|28261825|gb|EAA25329.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           sibirica 246]
 gi|157801005|gb|ABV76258.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908329|gb|ABY72625.1| ribonucleoside-diphosphate reductase beta chain [Rickettsia
           rickettsii str. Iowa]
 gi|228021796|gb|ACP53504.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia africae
           ESF-5]
 gi|238624358|gb|ACR47064.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           peacockii str. Rustic]
          Length = 328

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRTTEYSKAA 309


>gi|67459102|ref|YP_246726.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia felis
           URRWXCal2]
 gi|67004635|gb|AAY61561.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia felis
           URRWXCal2]
          Length = 327

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRATEYSKAA 309


>gi|31322342|gb|AAP15464.1| ribonucleotide reductase small subunit [Rickettsia rickettsii str.
           'Sheila Smith']
          Length = 336

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 186 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 245

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 246 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 301

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 302 HTNFFENRTTEYSKAA 317


>gi|15604372|ref|NP_220888.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           prowazekii str. Madrid E]
 gi|51473694|ref|YP_067451.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia typhi
           str. Wilmington]
 gi|3861064|emb|CAA14964.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN (nrdB) [Rickettsia
           prowazekii]
 gi|51460006|gb|AAU03969.1| Ribonucleotide reductase [Rickettsia typhi str. Wilmington]
 gi|292572126|gb|ADE30041.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia
           prowazekii Rp22]
          Length = 324

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + +RDE+LH N  I +      ENP +WT+  +++      T++H E   +
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTETLRKRIYEACTTIVHFEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E+A+       G  GL A    QY+++IA+RR  Q+GL+ ++    NP PW+ E+++  +
Sbjct: 238 ELAFE----VGGIEGLTAYEVRQYIRYIADRRLMQLGLKDVYLVNHNPLPWLDEMLNGVE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + A
Sbjct: 294 HTNFFENRATEYSKAA 309


>gi|114327552|ref|YP_744709.1| ribonucleotide-diphosphate reductase subunit beta [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315726|gb|ABI61786.1| ribonucleoside-diphosphate reductase beta chain [Granulibacter
           bethesdensis CGDNIH1]
          Length = 339

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 78/136 (57%), Gaps = 9/136 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTML-----HEATLLEI 57
           G+ +   + +RDE+LH    I + +    EN  +WT++ +Q+ R +      HE   +++
Sbjct: 200 GMGQIVSWSVRDETLHCLSIIKLFHVFIDENREIWTEDLRQEIRQICATIVEHEDAFIDL 259

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
           A+   ++     GL+A   + Y+++IA+RR  Q+GLEPLF    NP PW+ ++++  +  
Sbjct: 260 AFELGSVE----GLDAAQVKSYIRYIADRRLIQLGLEPLFHVERNPLPWIDDMLNAVEHA 315

Query: 118 NFFETRVTEYQQGAGL 133
           NFFE R TEY + + +
Sbjct: 316 NFFENRATEYSRASTV 331


>gi|182436093|ref|YP_001823812.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326776718|ref|ZP_08235983.1| Ribonucleoside-diphosphate reductase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464609|dbj|BAG19129.1| putative ribonucleoside-diphosphate reductase small subunit
           [Streptomyces griseus subsp. griseus NBRC 13350]
 gi|326657051|gb|EGE41897.1| Ribonucleoside-diphosphate reductase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 338

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 74/126 (58%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPDLFDDALQQQVTDMLKEAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  QY++ +A++R  ++G  P    +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGEGLPGMNTESMRQYLECVADQRLARLGF-PTVYGSENPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RPSAYQ 325


>gi|254384639|ref|ZP_04999978.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces sp.
           Mg1]
 gi|194343523|gb|EDX24489.1| ribonucleoside-diphosphate reductase beta chain [Streptomyces sp.
           Mg1]
          Length = 338

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKEAVDAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 262 LCGDGLPGMNTESMREYLECVADQRLVRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 319

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 320 RPSAYQ 325


>gi|302536805|ref|ZP_07289147.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
 gi|302445700|gb|EFL17516.1| ribonucleoside-diphosphate reductase subunit beta [Streptomyces sp.
           C]
          Length = 356

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ +  +
Sbjct: 220 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKEAVEAELQFGRD 279

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 280 LCGDGLPGMNTDSMREYLECVADQRLVRLGFPPVYG-SQNPFSFM-ELQGVQELTNFFER 337

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 338 RPSAYQ 343


>gi|311898297|dbj|BAJ30705.1| putative ribonucleoside-diphosphate reductase subunit beta
           [Kitasatospora setae KM-6054]
          Length = 339

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES+H++F   V++ ++ E P L+  +  ++   ML EA   E+ +A +
Sbjct: 203 GLATGTNWVFRDESMHMDFAFSVVDTVREEEPDLFDDKMARQVTEMLEEAVEAELQFARD 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  +Y+Q +A++R  ++GL P+   + NPF +M E+ ++++  NFFE 
Sbjct: 263 LCGEGLPGMNTESMREYLQAVADQRLARLGL-PIRYGSTNPFGFM-ELQNVQELTNFFER 320

Query: 123 RVTEYQ 128
           RV+ YQ
Sbjct: 321 RVSAYQ 326


>gi|11544904|emb|CAC17630.1| class I ribonucleotide-diphosphate reductase small subunit chain
           [Streptomyces jumonjinensis]
          Length = 322

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    QQ+   ML EA   E+ +  +
Sbjct: 203 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLQEAVEAELQFGSD 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 263 LCGDGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SENPFSFM-ELQGVQELTNFFER 320

Query: 123 R 123
           R
Sbjct: 321 R 321


>gi|296536499|ref|ZP_06898590.1| ribonucleotide-diphosphate reductase subunit beta [Roseomonas
           cervicalis ATCC 49957]
 gi|296263178|gb|EFH09712.1| ribonucleotide-diphosphate reductase subunit beta [Roseomonas
           cervicalis ATCC 49957]
          Length = 343

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 74/136 (54%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK-----SRTMLHEATLL 55
           M G+ +   + +RDE+LH    I +      ENP +WT++ +       +  + HE   +
Sbjct: 187 MKGMGQIVSWSVRDETLHCLSVIRLFRTFIQENPEIWTEQLKADLVEICTTIVEHEDAFI 246

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+       G  G+     +QY++FIA+RR  Q+GLEP +   +NP PW+ E+++  +
Sbjct: 247 DLAFEL----GGVQGMEPEDVKQYIRFIADRRLQQLGLEPHYGTEKNPLPWLDEILNAVE 302

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 303 HMNFFEGRATEYSKAS 318


>gi|149916691|ref|ZP_01905193.1| putative ribonucleoside-diphosphate reductase beta chain
           [Plesiocystis pacifica SIR-1]
 gi|149822408|gb|EDM81797.1| putative ribonucleoside-diphosphate reductase beta chain
           [Plesiocystis pacifica SIR-1]
          Length = 356

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 71/134 (52%), Gaps = 2/134 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F   VI+ ++ + P L+  E +     M+ EA   E+A+A +
Sbjct: 220 GLAAGTNWVFRDESAHMAFAFSVIDVVRDQEPELFDAELEAAVVEMIEEAVACEVAFAED 279

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  GL       Y+++ A++R  ++G+   +  T NP  +M E+ D+ +  NFFE 
Sbjct: 280 LLGLGVAGLTVADLRAYLEYCADQRLQRLGMATRYGST-NPLSFM-ELQDIPELANFFER 337

Query: 123 RVTEYQQGAGLKWD 136
           RV+ YQ G     D
Sbjct: 338 RVSAYQHGVSGTID 351


>gi|108763495|ref|YP_633213.1| ribonucleoside-diphosphate reductase subunit beta [Myxococcus
           xanthus DK 1622]
 gi|108467375|gb|ABF92560.1| ribonucleoside-diphosphate reductase, beta subunit [Myxococcus
           xanthus DK 1622]
          Length = 349

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 74/131 (56%), Gaps = 2/131 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  + I   + E P L+  + ++    ML EA   E  +A +
Sbjct: 209 GLAAGTNWVFRDESAHMAFAFESIQVARKEEPDLFDAQMERDVVAMLREAVECETQFAQD 268

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G +GL+      Y++++A++R   +G+ P+F  T+NP  +M ++ D+++  NFFE 
Sbjct: 269 LLSGGVMGLSVQDMRGYLEYVADQRLQMLGMTPVFG-TKNPLHFM-DLQDVQELTNFFER 326

Query: 123 RVTEYQQGAGL 133
           RV+ YQ   G+
Sbjct: 327 RVSSYQVAVGV 337


>gi|11544907|emb|CAC17632.1| class I ribonucleotide-diphosphate reductase small chain
           [Streptomyces microflavus]
          Length = 321

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 73/121 (60%), Gaps = 2/121 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H+NF  +V++ ++ E P L+    Q++   ML EA   E+ +  +
Sbjct: 202 GLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQEQVTAMLKEAVEAELQFGRD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+N  S  +Y+Q +A++R  ++G  P++  +ENPF +M E+  +++  NFFE 
Sbjct: 262 LCGEGLPGMNTESMREYLQCVADQRLTRLGFAPVYG-SENPFAFM-ELQGVQELTNFFER 319

Query: 123 R 123
           R
Sbjct: 320 R 320


>gi|271967540|ref|YP_003341736.1| ribonucleoside-diphosphate reductase [Streptosporangium roseum DSM
           43021]
 gi|270510715|gb|ACZ88993.1| Ribonucleoside-diphosphate reductase [Streptosporangium roseum DSM
           43021]
          Length = 331

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           + G+A    ++ RDES+H+ F   V++ ++ E P L+  +   +   M+ EA   E+A+A
Sbjct: 193 LSGLATGTNWVFRDESMHMEFAFSVVDTVRAEEPDLFDDKLGAQVTQMIEEAVEAELAFA 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +    G  G+N     QY++++A++R  ++   P+   T NPF +M E+ D+++  NFF
Sbjct: 253 ADLCGDGMSGMNVEQMRQYLEYVADQRLVRLRF-PVRYGTANPFAFM-ELQDVQELANFF 310

Query: 121 ETRVTEYQ 128
           E RV+ YQ
Sbjct: 311 ERRVSAYQ 318


>gi|154250961|ref|YP_001411785.1| ribonucleotide-diphosphate reductase subunit beta [Parvibaculum
           lavamentivorans DS-1]
 gi|154154911|gb|ABS62128.1| Ribonucleoside-diphosphate reductase [Parvibaculum lavamentivorans
           DS-1]
          Length = 319

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 78/136 (57%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   +  RDE+LH    + +      ENP +WT+E ++       T++H E   +
Sbjct: 178 MKGMGQIVTWSARDETLHTVSAMKLFRTFVDENPEIWTEELRRDIYKACETIIHHEDAFI 237

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+   ++     GL+A   + Y+++IA+RR  Q+ L+P+++  +NP PWM E+++  +
Sbjct: 238 DLAFEMGSIE----GLSAQEVKNYIRYIADRRLVQLNLQPIYRTEKNPLPWMDEMLNGIE 293

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 294 HTNFFENRATEYSKAS 309


>gi|182419335|ref|ZP_02950587.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum 5521]
 gi|237666940|ref|ZP_04526925.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182376666|gb|EDT74238.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum 5521]
 gi|237658139|gb|EEP55694.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 344

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 76/135 (56%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ EN  L+T+E + + R M+      EI + 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIIKELQNENAELFTEEIKNELREMMKTGVEQEILWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E+Y++++ N+R  +I LEPLF+ +  NP PW+    +    K +
Sbjct: 266 HYVIGDKIQGINKKLIEEYIKYLGNKRLKEINLEPLFEGHDVNPAPWVDRQSNANSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE R T Y + A L
Sbjct: 326 FFEARSTAYAKAATL 340


>gi|318060206|ref|ZP_07978929.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. SA3_actG]
 gi|318077113|ref|ZP_07984445.1| Ribonucleoside-diphosphate reductase [Streptomyces sp. SA3_actF]
          Length = 345

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + + + + ML  A   E+ +A +
Sbjct: 209 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLEAEVKEMLAGAVDAELQFARD 268

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+  +++  NFFE 
Sbjct: 269 LCGDGLPGMNTESMREYLQCVADQRLVRLGFSPVYG-SSNPFSFM-ELQGVQELTNFFER 326

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 327 RPSAYQ 332


>gi|302521843|ref|ZP_07274185.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB78]
 gi|302430738|gb|EFL02554.1| ribonucleoside-diphosphate reductase, beta subunit [Streptomyces
           sp. SPB78]
          Length = 345

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  DV++ ++ E P L+  + + + + ML  A   E+ +A +
Sbjct: 209 GLATGTNWVFRDETMHMSFAFDVVDTVRKEEPELFDDKLEAEVKEMLAGAVDAELQFARD 268

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  +Y+Q +A++R  ++G  P++  + NPF +M E+  +++  NFFE 
Sbjct: 269 LCGDGLPGMNTESMREYLQCVADQRLVRLGFSPVYG-SSNPFSFM-ELQGVQELTNFFER 326

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 327 RPSAYQ 332


>gi|291303011|ref|YP_003514289.1| Ribonucleoside-diphosphate reductase [Stackebrandtia nassauensis
           DSM 44728]
 gi|290572231|gb|ADD45196.1| Ribonucleoside-diphosphate reductase [Stackebrandtia nassauensis
           DSM 44728]
          Length = 338

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 75/130 (57%), Gaps = 2/130 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+NF   V++ ++ E P L+  E  +    M+ EA   E+ +A +
Sbjct: 202 GLATGTNWVFRDESCHMNFAFSVVDVVRNEEPELFDDELTEAVTRMIEEAVAAELQFARD 261

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
              +G  G+     + Y++++A++R  ++G+ P+   ++NPF +M+ + D+++  NFFE 
Sbjct: 262 LCGEGMPGMTVNDMKSYLEYVADQRLTRLGM-PVRYGSKNPFGFMA-LQDVQELTNFFER 319

Query: 123 RVTEYQQGAG 132
           R T YQ   G
Sbjct: 320 RPTAYQVAVG 329


>gi|290957506|ref|YP_003488688.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           scabiei 87.22]
 gi|260647032|emb|CBG70131.1| ribonucleotide-diphosphate reductase small chain [Streptomyces
           scabiei 87.22]
          Length = 355

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDE++H++F  +V++ ++ E P L+ +  +Q+   ML EA   E+ +  +
Sbjct: 219 GLATGTNWVFRDETMHMSFAFEVVDTVRKEEPELFDELLRQQVTDMLKEAVEAELQFGRD 278

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
               G  G+N  S  QY++ +A++R  ++G  P++  ++NPF +M E+  +++  NFFE 
Sbjct: 279 LCGDGLPGMNTESMRQYLECVADQRLTRLGFAPVYG-SQNPFSFM-ELQGVQELTNFFER 336

Query: 123 RVTEYQ 128
           R + YQ
Sbjct: 337 RPSAYQ 342


>gi|156087150|ref|XP_001610982.1| ribonucleoside-diphosphate reductase small subunit [Babesia bovis
           T2Bo]
 gi|154798235|gb|EDO07414.1| ribonucleoside-diphosphate reductase small subunit, putative
           [Babesia bovis]
          Length = 339

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 78/133 (58%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +FG  + +++K + P        +  + ++ EA  +E  + 
Sbjct: 202 MPGLTFSNELIARDEGLHADFGCFIYSKLKHKLP-------AECVQQIIKEAVAVERVFV 254

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R    +G+ P++K T+NPF WM E+I ++ + NFF
Sbjct: 255 CDSLPTDLIGMNSMLMAQYIEFVADRLLQALGVPPVYK-TKNPFEWM-ELISVQGKTNFF 312

Query: 121 ETRVTEYQQGAGL 133
           E RV EYQ+   L
Sbjct: 313 EKRVGEYQKSGIL 325


>gi|190572323|ref|YP_001970168.1| putative ribonucleotide diphosphate reductase, small chain
           [Stenotrophomonas maltophilia K279a]
 gi|190010245|emb|CAQ43853.1| putative ribonucleotide diphosphate reductase, small chain
           [Stenotrophomonas maltophilia K279a]
          Length = 339

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 73/129 (56%), Gaps = 2/129 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  + +  ++ E P L+ +E +Q+   ML EA   E+ +A +
Sbjct: 203 GLASGTNWVFRDESAHMEFAFESVRVVREEEPDLFDEEMKQQVYDMLAEAIECEVQFAED 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  G++     QY+Q  A++   ++G+E  +    NP P+M E+ D+++  NFFE 
Sbjct: 263 VLSGGVAGISTRDMRQYLQHCADQHFAKLGMEKKYN-VRNPLPFM-ELQDVQELTNFFER 320

Query: 123 RVTEYQQGA 131
           RV+ YQ G 
Sbjct: 321 RVSAYQVGV 329


>gi|226950223|ref|YP_002805314.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A2 str. Kyoto]
 gi|226843961|gb|ACO86627.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A2 str. Kyoto]
          Length = 342

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K ENPH++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKNENPHIFTEELEEEFRQMMRIGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYLEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|254521240|ref|ZP_05133295.1| ribonucleoside-diphosphate reductase, beta subunit
           [Stenotrophomonas sp. SKA14]
 gi|219718831|gb|EED37356.1| ribonucleoside-diphosphate reductase, beta subunit
           [Stenotrophomonas sp. SKA14]
          Length = 339

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 72/129 (55%), Gaps = 2/129 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  + +  ++ E P L+  E +Q+   ML EA   E+ +A +
Sbjct: 203 GLASGTNWVFRDESAHMEFAFESVRVVREEEPDLFDDEMKQQVYDMLAEAIECEVQFAED 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  G++     QY+Q  A++   ++G+E  +    NP P+M E+ D+++  NFFE 
Sbjct: 263 VLSGGVAGISTRDMRQYLQHCADQHFAKLGMEKKYN-VRNPLPFM-ELQDVQELTNFFER 320

Query: 123 RVTEYQQGA 131
           RV+ YQ G 
Sbjct: 321 RVSAYQVGV 329


>gi|325119319|emb|CBZ54873.1| hypothetical protein NCLIV_052980 [Neospora caninum Liverpool]
          Length = 392

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (56%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +Q+K + P        +  + M+ EA  +E A+ 
Sbjct: 255 MPGLTFSNELISRDEGLHADFACLLYSQLKNKLP-------DKVVQDMVREAVTVERAFI 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N  S  QY++F+A+R    +G+  +F +  NPF WM E+I L+ + NFF
Sbjct: 308 CEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKIF-FATNPFDWM-ELISLQGKTNFF 365

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 366 EKRVGEYQK-AGVMAD 380


>gi|91205547|ref|YP_537902.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           bellii RML369-C]
 gi|91069091|gb|ABE04813.1| Ribonucleoside-diphosphate reductase beta chain [Rickettsia bellii
           RML369-C]
          Length = 324

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 72/135 (53%), Gaps = 7/135 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLHEATLLE 56
           M G+ +   + +RDE+LH N  I +      ENP +WT+  + +      T++H      
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTENLRSRIYKACTTIVHFEDAF- 236

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
           IA A E    G  GL A     Y+++IA+RR  Q+GL+ ++    NP PW+ E+++  + 
Sbjct: 237 IALAFEV--GGIEGLTADEVRLYIRYIADRRLFQLGLKDIYMVKNNPLPWLDEMLNGVEH 294

Query: 117 KNFFETRVTEYQQGA 131
            NFFE R TEY + A
Sbjct: 295 TNFFENRATEYSKAA 309


>gi|157827263|ref|YP_001496327.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           bellii OSU 85-389]
 gi|157802567|gb|ABV79290.1| ribonucleotide-diphosphate reductase subunit beta [Rickettsia
           bellii OSU 85-389]
          Length = 324

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 72/135 (53%), Gaps = 7/135 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLHEATLLE 56
           M G+ +   + +RDE+LH N  I +      ENP +WT+  + +      T++H      
Sbjct: 178 MKGMGQIIAWSVRDETLHTNSIITLFKTFVRENPEVWTENLRSRIYKACTTIVHFEDAF- 236

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
           IA A E    G  GL A     Y+++IA+RR  Q+GL+ ++    NP PW+ E+++  + 
Sbjct: 237 IALAFEV--GGIEGLTADEVRLYIRYIADRRLFQLGLKDIYMVKNNPLPWLDEMLNGVEH 294

Query: 117 KNFFETRVTEYQQGA 131
            NFFE R TEY + A
Sbjct: 295 TNFFENRATEYSKAA 309


>gi|221480670|gb|EEE19110.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii GT1]
          Length = 391

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (56%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +Q+K + P        +  + M+ EA  +E A+ 
Sbjct: 254 MPGLTFSNELISRDEGLHADFACLLYSQLKHKLP-------DKVVQDMVREAVTVERAFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N  S  QY++F+A+R    +G+  +F +  NPF WM E+I L+ + NFF
Sbjct: 307 CEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKIF-FATNPFDWM-ELISLQGKTNFF 364

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 365 EKRVGEYQK-AGVMAD 379


>gi|237845387|ref|XP_002371991.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii ME49]
 gi|211969655|gb|EEB04851.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii ME49]
 gi|221501644|gb|EEE27410.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Toxoplasma gondii VEG]
          Length = 391

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 77/136 (56%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +Q+K + P        +  + M+ EA  +E A+ 
Sbjct: 254 MPGLTFSNELISRDEGLHADFACLLYSQLKHKLP-------DKVVQDMVREAVTVERAFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N  S  QY++F+A+R    +G+  +F +  NPF WM E+I L+ + NFF
Sbjct: 307 CEALPVDLIGMNNRSMAQYIEFVADRLLTSLGVPKIF-FATNPFDWM-ELISLQGKTNFF 364

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 365 EKRVGEYQK-AGVMAD 379


>gi|152993970|ref|YP_001359691.1| ribonucleotide-diphosphate reductase subunit beta [Sulfurovum sp.
           NBC37-1]
 gi|151425831|dbj|BAF73334.1| ribonucleoside-diphosphate reductase, beta subunit [Sulfurovum sp.
           NBC37-1]
          Length = 339

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN  K E P L+TKE       M  +A  LE  + 
Sbjct: 203 MLGTAQMIRFIQRDEVTHLLLFQNMINATKRERPELFTKELIDDVYQMFRDAVKLECEWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY+Q++A++R H +GLE ++   E+P  W+        +K NF
Sbjct: 263 TYITQGQILGLTNEIIEQYIQYLADKRLHAVGLEKIYN-VEHPIKWVDNFSQFNDQKTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 322 FEGNVTNYSKGS 333


>gi|840719|emb|CAA54549.1| ribonucleotide reductase R2 [Arabidopsis thaliana]
          Length = 340

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +I+ +++  P        +K   ++HEA  +E  + 
Sbjct: 199 MPGLTFSNELISRDEGLHCDFACLLISLLQLHVP-------LEKVYQIVHEAVEIETEFV 251

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY+QF+A+R    +G E  +K  ENPF WM E I L+ + NFF
Sbjct: 252 CKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-AENPFDWM-EFISLQGKTNFF 309

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 310 EKRVGEYQKAS 320


>gi|15896521|ref|NP_349870.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           acetobutylicum ATCC 824]
 gi|15026352|gb|AAK81210.1|AE007823_4 Ribonucleotide reductase beta subunit [Clostridium acetobutylicum
           ATCC 824]
 gi|325510679|gb|ADZ22315.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           acetobutylicum EA 2018]
          Length = 344

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 75/135 (55%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P ++T+E +++ + M+      EI + 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIIKELQKEEPDMFTEEIKKELKDMVKTGVENEITWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E Y++++ NRR   IG EP+++ Y ENP  W+    D    K +
Sbjct: 266 HYVIGDNIQGINKKLIEDYIKYLGNRRLEAIGFEPIYEGYDENPALWVDIYADANSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y + + L
Sbjct: 326 FFEAKSTAYAKASTL 340


>gi|194363985|ref|YP_002026595.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia
           R551-3]
 gi|194346789|gb|ACF49912.1| Ribonucleoside-diphosphate reductase [Stenotrophomonas maltophilia
           R551-3]
          Length = 339

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 2/129 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H++F  + ++ I+ E P L+  + +Q    ML EA   E+ +A +
Sbjct: 203 GLASGTNWVFRDESAHMDFAFECVDVIREEEPDLFDDKMKQDVYDMLAEAIECEVQFAED 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  G++     QY+Q  A+   H++G+E  +    NP  +M E+ D+++  NFFE 
Sbjct: 263 VLSGGVAGISTRDMRQYLQHCADNHFHRLGMERKYN-VRNPLSFM-ELQDVQELTNFFER 320

Query: 123 RVTEYQQGA 131
           R + YQ G 
Sbjct: 321 RASAYQVGV 329


>gi|313894221|ref|ZP_07827786.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           oral taxon 158 str. F0412]
 gi|313441045|gb|EFR59472.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           oral taxon 158 str. F0412]
          Length = 342

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E ++K   M+ + T  EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEEKITDMIRQGTENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|152989800|ref|YP_001355522.1| ribonucleotide-diphosphate reductase subunit beta [Nitratiruptor
           sp. SB155-2]
 gi|151421661|dbj|BAF69165.1| ribonucleoside-diphosphate reductase, beta subunit [Nitratiruptor
           sp. SB155-2]
          Length = 341

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +K E P L+TKE       M   A  LE ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLLIFQNMINTVKKERPELFTKELIDDVYKMFEGAVDLETSWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY++++A+ R  ++GLEP++   E+P  W+ +      +K NF
Sbjct: 265 KYITQGQILGLTDEIIEQYIKYLADDRLKRVGLEPMYN-VEHPIKWVDDFSKFNDQKTNF 323

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 324 FEGNVTNYSKGS 335


>gi|56416698|ref|YP_153772.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. St. Maries]
 gi|254994906|ref|ZP_05277096.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Mississippi]
 gi|255003042|ref|ZP_05278006.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Puerto Rico]
 gi|255004164|ref|ZP_05278965.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           marginale str. Virginia]
 gi|56387930|gb|AAV86517.1| ribonuceoside-diphosphate reductase beta chain [Anaplasma marginale
           str. St. Maries]
          Length = 324

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH    I + N    EN  +W +  +++          LE  + 
Sbjct: 181 MKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDENLREELYGACRVIVSLEDEFI 240

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++  +  NF
Sbjct: 241 DLAFALGDVEGLSAAEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILNGVEHTNF 300

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 301 FENRVTEYSRAA 312


>gi|222475064|ref|YP_002563479.1| ribonuceoside-diphosphate reductase beta chain (nrdB) [Anaplasma
           marginale str. Florida]
 gi|222419200|gb|ACM49223.1| ribonuceoside-diphosphate reductase beta chain (nrdB) [Anaplasma
           marginale str. Florida]
          Length = 343

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 1/132 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH    I + N    EN  +W +  +++          LE  + 
Sbjct: 200 MKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDENLREELYGACRVIVSLEDEFI 259

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++  +  NF
Sbjct: 260 DLAFALGDVEGLSAAEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILNGVEHTNF 319

Query: 120 FETRVTEYQQGA 131
           FE RVTEY + A
Sbjct: 320 FENRVTEYSRAA 331


>gi|51891459|ref|YP_074150.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium
           thermophilum IAM 14863]
 gi|51855148|dbj|BAD39306.1| ribonucleoside-diphosphate reductase beta subunit [Symbiobacterium
           thermophilum IAM 14863]
          Length = 346

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 1/137 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A + Q+I RDE  H+    +++N ++ E P L+T +     R M+ +A   E+A+A
Sbjct: 208 MKGTATEIQFINRDEITHVAVFQNILNGLRQERPQLFTPQLDADLRAMIRQAAEHEMAWA 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
              +     GL+    + Y++ +A++R   +G EPL+    NP  W+    +L + K +F
Sbjct: 268 AYCVGNRIQGLSGEVLQGYVKHLADQRARALGFEPLYGNHPNPIKWVESFSNLNQTKADF 327

Query: 120 FETRVTEYQQGAGLKWD 136
           FETRVT Y +   +  D
Sbjct: 328 FETRVTNYAKSTNIDLD 344


>gi|229827460|ref|ZP_04453529.1| hypothetical protein GCWU000182_02849 [Abiotrophia defectiva ATCC
           49176]
 gi|229788398|gb|EEP24512.1| hypothetical protein GCWU000182_02849 [Abiotrophia defectiva ATCC
           49176]
          Length = 354

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++  ENP ++T E + + R M+   TL EI + 
Sbjct: 214 MTATSTIFKYINRDEITHLVLFQNIIRELMKENPEIFTDELKGELREMVKVGTLNEIEWG 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    E+Y+++++N R   IGL   F + TENP  W+    +L   K +
Sbjct: 274 QYVTNNEILGINNELIERYIKYLSNLRLRAIGLPVWFPEITENPMAWIESFSNLNATKTD 333

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 334 FFEAKVTNYTKAAAFDFD 351


>gi|294794440|ref|ZP_06759576.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           3_1_44]
 gi|294454770|gb|EFG23143.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           3_1_44]
          Length = 342

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ + T  EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGTENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|88658048|ref|YP_507564.1| ribonucleotide-diphosphate reductase subunit beta [Ehrlichia
           chaffeensis str. Arkansas]
 gi|88599505|gb|ABD44974.1| ribonucleoside-diphosphate reductase, beta subunit [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 324

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W    +Q+    L+EA  + ++  
Sbjct: 181 MKGMGQIIAWSVRDETLHTESIIRLFNTFIQENYEIWDDSLKQE----LYEACRIIVSLE 236

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL++   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 237 DEFINLAFACGDVEGLSSKEVKEYIRYIANRRLLQLNLEPIYDTNKNPLLWLDEILNGVE 296

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 297 HTNFFENRVTEYARAA 312


>gi|68171256|ref|ZP_00544659.1| Ribonucleoside-diphosphate reductase [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|67999338|gb|EAM85984.1| Ribonucleoside-diphosphate reductase [Ehrlichia chaffeensis str.
           Sapulpa]
          Length = 294

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W    +Q+    L+EA  + ++  
Sbjct: 151 MKGMGQIIAWSVRDETLHTESIIRLFNTFIQENYEIWDDSLKQE----LYEACRIIVSLE 206

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL++   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 207 DEFINLAFACGDVEGLSSKEVKEYIRYIANRRLLQLNLEPIYDTNKNPLLWLDEILNGVE 266

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 267 HTNFFENRVTEYARAA 282


>gi|269958883|ref|YP_003328672.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           centrale str. Israel]
 gi|269848714|gb|ACZ49358.1| ribonucleotide-diphosphate reductase subunit beta [Anaplasma
           centrale str. Israel]
          Length = 332

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   +  RDE+LH    I + N    EN  +W        R  L+ A  + ++  
Sbjct: 189 MKGMGQIIAWSARDETLHTESIIRLFNTFIHENQEIWDANL----RAELYGACRVIVSLE 244

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL+A   ++Y+++IANRR  Q+ LEP++    NP PW+ E+++  +
Sbjct: 245 DEFIDLAFALGDVEGLSASEVKRYIRYIANRRLKQLDLEPIYGDNVNPLPWLDEILNGVE 304

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 305 HTNFFENRVTEYSRAA 320


>gi|162452149|ref|YP_001614516.1| ribonucleotide-diphosphate reductase [Sorangium cellulosum 'So ce
           56']
 gi|161162731|emb|CAN94036.1| Ribonucleotide-diphosphate reductase [Sorangium cellulosum 'So ce
           56']
          Length = 339

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 2/128 (1%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+A    ++ RDES H+ F  +V++  + E P L+     +    M+ EA   E  +A +
Sbjct: 203 GLAAGTSWVFRDESAHMRFAFEVVSTARREEPELFDAGLARSILDMMDEAIACEARFAED 262

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +  G  G++A    +Y++F A++R   +G+ P     +NPF +M ++ D+++  NFFE 
Sbjct: 263 LLGAGVAGMSARDVRRYLEFCADQRLATLGM-PKRYGAKNPFSFM-DLQDVQEVTNFFER 320

Query: 123 RVTEYQQG 130
           RV+ YQ G
Sbjct: 321 RVSAYQVG 328


>gi|57239055|ref|YP_180191.1| ribonucleotide-diphosphate reductase subunit beta [Ehrlichia
           ruminantium str. Welgevonden]
 gi|15811135|gb|AAL08816.1|AF308664_1 hypothetical ribonucleoside reductase beta chain [Ehrlichia
           ruminantium]
 gi|57161134|emb|CAH58047.1| putative ribonucleoside-diphosphate reductase beta chain [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 324

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W  + +++    L+EA  + +   
Sbjct: 181 MKGMGQIIAWSVRDETLHTESIIRLFNTFIQENYEIWDDDLKKE----LYEACSVIVTLE 236

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL+A   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 237 DEFINLAFACGDVEGLSAQEVKEYIRYIANRRLIQLNLEPIYSANKNPLLWLDEILNGVE 296

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 297 HTNFFENRVTEYTRAA 312


>gi|153940168|ref|YP_001392091.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum F str. Langeland]
 gi|170756361|ref|YP_001782419.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B1 str. Okra]
 gi|152936064|gb|ABS41562.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum F str. Langeland]
 gi|169121573|gb|ACA45409.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum B1 str. Okra]
 gi|322807123|emb|CBZ04697.1| ribonucleotide reductase of class Ia (aerobic),beta subunit
           [Clostridium botulinum H04402 065]
          Length = 342

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRMGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|58578998|ref|YP_197210.1| ribonucleotide-diphosphate reductase subunit beta [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417624|emb|CAI26828.1| Ribonucleoside-diphosphate reductase beta chain [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 329

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W  + +++    L+EA  + +   
Sbjct: 186 MKGMGQIIAWSVRDETLHTESIIRLFNTFIQENYEIWDDDLKKE----LYEACSVIVTLE 241

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL+A   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 242 DEFINLAFACGDVEGLSAQEVKEYIRYIANRRLIQLNLEPIYSANKNPLLWLDEILNGVE 301

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 302 HTNFFENRVTEYTRAA 317


>gi|282849773|ref|ZP_06259157.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           parvula ATCC 17745]
 gi|282580710|gb|EFB86109.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           parvula ATCC 17745]
          Length = 342

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  ENP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKENPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|254456975|ref|ZP_05070403.1| ribonucleoside-diphosphate reductase, beta subunit
           [Campylobacterales bacterium GD 1]
 gi|207085767|gb|EDZ63051.1| ribonucleoside-diphosphate reductase, beta subunit
           [Campylobacterales bacterium GD 1]
          Length = 340

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T + +++   M  EA  LE  + 
Sbjct: 203 MLGSAQMIRFIQRDEVTHLVLFQNLINTLRKERPDLFTDKLKEEVIAMFKEAVQLESEWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY++F+A+ R   +G E L+  T NP  W+ +      +K NF
Sbjct: 263 KYITQGQILGLTNDIVEQYIKFLADERLTAVGFEKLYNVT-NPIKWVDDFAKFNDQKTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 322 FEGTVTNYSKGS 333


>gi|58040422|ref|YP_192386.1| ribonucleotide-diphosphate reductase subunit beta [Gluconobacter
           oxydans 621H]
 gi|58002836|gb|AAW61730.1| Ribonucleoside-diphosphate reductase beta chain [Gluconobacter
           oxydans 621H]
          Length = 339

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 72/130 (55%), Gaps = 1/130 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+ +   + +RDE+LH    I +      EN  +WT EF+++   +       E A+   
Sbjct: 195 GMGQIVSWSVRDETLHCLSMIRLFRTFVRENSEIWTPEFREELTQICRTTVEHEDAFIDL 254

Query: 63  TMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFE 121
               G V G+++   ++Y++FIA+RR  Q+GL+P++    NP PW+ ++++  +  NFFE
Sbjct: 255 CFEMGPVEGMSSEDVKRYIRFIADRRLTQLGLDPVYGQESNPLPWIDDMLNAVEHANFFE 314

Query: 122 TRVTEYQQGA 131
            R TEY + +
Sbjct: 315 NRSTEYSRAS 324


>gi|73666936|ref|YP_302952.1| ribonucleotide-diphosphate reductase subunit beta [Ehrlichia canis
           str. Jake]
 gi|72394077|gb|AAZ68354.1| Ribonucleoside-diphosphate reductase [Ehrlichia canis str. Jake]
          Length = 324

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W    + +    L+EA  + ++  
Sbjct: 181 MKGMGQIIAWSVRDETLHTESIIRLFNTFVQENYEIWDDSLKHE----LYEACKIIVSLE 236

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL+A   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 237 DEFINLAFACGDVEGLSAKEVKKYIRYIANRRLLQLNLEPIYDANKNPLLWLDEILNGVE 296

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 297 HTNFFENRVTEYARAA 312


>gi|168184457|ref|ZP_02619121.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Bf]
 gi|237796249|ref|YP_002863801.1| ribonucleoside-diphosphate reductase subunit beta [Clostridium
           botulinum Ba4 str. 657]
 gi|182672468|gb|EDT84429.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Bf]
 gi|229263158|gb|ACQ54191.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum Ba4 str. 657]
          Length = 342

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRIGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYLEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|150015087|ref|YP_001307341.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           beijerinckii NCIMB 8052]
 gi|149901552|gb|ABR32385.1| Ribonucleoside-diphosphate reductase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 344

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ ENP L+T+E + + R M+      EI + 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIIKELQNENPELFTEEVKNELRNMMKIGVEQEILWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE-NPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E Y++++ N+R  +I L PLFK  + NP  W+  + +    K +
Sbjct: 266 HYVIGDKIQGINKQLIENYIKYLGNKRLKEINLSPLFKEQDKNPASWVDTLSNANSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE R T Y +   L
Sbjct: 326 FFEARSTAYAKVTTL 340


>gi|58617056|ref|YP_196255.1| ribonucleotide-diphosphate reductase subunit beta [Ehrlichia
           ruminantium str. Gardel]
 gi|58416668|emb|CAI27781.1| Ribonucleoside-diphosphate reductase beta chain [Ehrlichia
           ruminantium str. Gardel]
          Length = 329

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH    I + N    EN  +W  + +++    L+EA  + +   
Sbjct: 186 MKGMGQIIAWSVRDETLHTESIIRLFNTFIQENYEIWDGDLKKE----LYEACSVIVTLE 241

Query: 61  HETMPKGFV-----GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
            E +   F      GL+A   ++Y+++IANRR  Q+ LEP++   +NP  W+ E+++  +
Sbjct: 242 DEFINLAFACGDVEGLSAQEVKEYIRYIANRRLIQLNLEPIYSANKNPLLWLDEILNGVE 301

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RVTEY + A
Sbjct: 302 HTNFFENRVTEYTRAA 317


>gi|307719930|ref|YP_003891070.1| Ribonucleoside-diphosphate reductase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978023|gb|ADN08058.1| Ribonucleoside-diphosphate reductase [Sulfurimonas autotrophica DSM
           16294]
          Length = 340

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T E +     M  EA  LE  + 
Sbjct: 203 MLGSAQMIRFIQRDEVTHLVLFQNLINTLRKERPDLFTDELRADVIEMFKEAVKLETEWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY+Q++A+ R + +G + L+  + NP  W+ +      +K NF
Sbjct: 263 KYITQGQILGLTDEIVEQYIQYLADDRLNSVGFDKLYNVS-NPIKWVDDFAKFNDQKTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 322 FEGTVTNYSKGS 333


>gi|148380773|ref|YP_001255314.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 3502]
 gi|153932443|ref|YP_001385057.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934989|ref|YP_001388527.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. Hall]
 gi|148290257|emb|CAL84376.1| ribonucleoside-diphosphate reductase beta chain [Clostridium
           botulinum A str. ATCC 3502]
 gi|152928487|gb|ABS33987.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930903|gb|ABS36402.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A str. Hall]
          Length = 342

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKNENLHIFTEELEEEFRQMMRMGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIEKYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|269798663|ref|YP_003312563.1| ribonucleotide reductase [Veillonella parvula DSM 2008]
 gi|294792661|ref|ZP_06757808.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           6_1_27]
 gi|269095292|gb|ACZ25283.1| ribonucleotide reductase [Veillonella parvula DSM 2008]
 gi|294456560|gb|EFG24923.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella sp.
           6_1_27]
          Length = 342

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|170761039|ref|YP_001788131.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169408028|gb|ACA56439.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum A3 str. Loch Maree]
          Length = 342

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRMGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDGFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|253827828|ref|ZP_04870713.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           canadensis MIT 98-5491]
 gi|313142391|ref|ZP_07804584.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
 gi|253511234|gb|EES89893.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           canadensis MIT 98-5491]
 gi|313131422|gb|EFR49039.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
          Length = 341

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 75/132 (56%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +K E+P L+TK+ +++   M  EA  +E A+ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINSVKKESPELFTKDLEEEVIEMFREAVKVETAWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   ++Y++++A+ R  +IGL  L+   ++P  W+       ++K NF
Sbjct: 265 EYITQGQILGLTSEIIQEYIKYLADERLRRIGLPTLYN-AKHPIKWVDSFSSFNEQKTNF 323

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 324 FEGNVTNYAKGS 335


>gi|303228685|ref|ZP_07315510.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-134-V-Col7a]
 gi|303230495|ref|ZP_07317254.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302514861|gb|EFL56844.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302516665|gb|EFL58582.1| ribonucleoside-diphosphate reductase, beta subunit [Veillonella
           atypica ACS-134-V-Col7a]
          Length = 342

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|238018468|ref|ZP_04598894.1| hypothetical protein VEIDISOL_00295 [Veillonella dispar ATCC 17748]
 gi|237864939|gb|EEP66229.1| hypothetical protein VEIDISOL_00295 [Veillonella dispar ATCC 17748]
          Length = 342

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I +++ E P L+T E + K   M+ +    EIA+ 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIRELRRERPDLFTPELEAKITDMIRQGAENEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL  L+ +  +NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNVLIERYIKYLANIRLEAIGLPHLYPEIKDNPMEWIESFSNLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|224418874|ref|ZP_03656880.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           canadensis MIT 98-5491]
          Length = 340

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 75/132 (56%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +K E+P L+TK+ +++   M  EA  +E A+ 
Sbjct: 204 MLGSAQMIRFIQRDEVTHLILFQNMINSVKKESPELFTKDLEEEVIEMFREAVKVETAWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   ++Y++++A+ R  +IGL  L+   ++P  W+       ++K NF
Sbjct: 264 EYITQGQILGLTSEIIQEYIKYLADERLRRIGLPTLYN-AKHPIKWVDSFSSFNEQKTNF 322

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 323 FEGNVTNYAKGS 334


>gi|78776214|ref|YP_392529.1| ribonucleotide-diphosphate reductase subunit beta [Sulfurimonas
           denitrificans DSM 1251]
 gi|78496754|gb|ABB43294.1| Ribonucleoside-diphosphate reductase [Sulfurimonas denitrificans
           DSM 1251]
          Length = 340

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+ ++ +++   M  EA  LE+A+ 
Sbjct: 203 MLGSAQMIRFIQRDEVTHLVLFQNLINSLRKERPDLFNEKLKEEVIEMFKEAVALEVAWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY+Q++A+ R   +G   L+  T NP  W+ +      +K NF
Sbjct: 263 KYITGGQILGLTDAIIEQYIQYLADDRLTSVGFAKLYNVT-NPIKWVDDFSKFNDQKTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  V  Y +G+
Sbjct: 322 FEGTVANYSKGS 333


>gi|242309209|ref|ZP_04808364.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pullorum MIT 98-5489]
 gi|239524250|gb|EEQ64116.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pullorum MIT 98-5489]
          Length = 341

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN  K E+P  +TK+ +++   M  EA  +EIA+ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLLLFQNMINSTKKESPEFFTKDLEEEVLEMFREAVKVEIAWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL A   ++Y++++A+ R  ++GL P+    ++P  W+       ++K NF
Sbjct: 265 EYITQGQILGLTAEIIQEYIKYLADDRLRRVGL-PVLYNAKHPIKWVDSFSSFNEQKTNF 323

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 324 FEGNVTNYAKGS 335


>gi|225432510|ref|XP_002279943.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 340

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++ + P  W     QK   ++HEA  +E  + 
Sbjct: 200 MPGLTFSNELISRDEGLHCDFACLLYSLLQKQLP--W-----QKVHHIVHEAVEIETQFV 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA    QY++F+A+R    +G E  +   ENPF WM E I L+ + NFF
Sbjct: 253 CEALPCALIGMNATLMSQYIKFVADRLLVALGYERKYN-VENPFDWM-EFISLQGKANFF 310

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 311 ERRVGDYQKAS 321


>gi|313683656|ref|YP_004061394.1| ribonucleotide reductase [Sulfuricurvum kujiense DSM 16994]
 gi|313156516|gb|ADR35194.1| ribonucleotide reductase [Sulfuricurvum kujiense DSM 16994]
          Length = 339

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T+E  ++   M  +A  LE A+ 
Sbjct: 203 MLGSAQMIRFIQRDEVTHLVLFQNIINTLRRERSDLFTEELIEEVYDMFRKAVELETAWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     EQY+Q++A++R   +GL+PL+  + +P  W+ +      +K NF
Sbjct: 263 KYITQGQILGLTNEIVEQYIQYLADQRLTAVGLKPLYNVS-HPIKWVDDFSKFNDQKTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 322 FEGTVTNYSKGS 333


>gi|168179222|ref|ZP_02613886.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum NCTC 2916]
 gi|182669722|gb|EDT81698.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum NCTC 2916]
          Length = 342

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 75/138 (54%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           +   +  ++YI RDE  HL    ++I ++K EN H++T+E +++ R M+      EI + 
Sbjct: 202 LTATSTIFKYINRDEVTHLVLFQNIIKELKNENSHIFTEELEEEFRQMMRIGVEHEIQWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIERYIKYLSNLRLVAIGLKPLYPEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|224000239|ref|XP_002289792.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975000|gb|EED93329.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 335

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 78/131 (59%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +++K+       K  Q++ +T+++EA  +E ++ 
Sbjct: 185 MPGLTFSNELISRDEGLHCSFACQLYSKLKL-------KLSQEEIQTIINEAVDVEKSFI 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G + ++  ++NPF WM ++I L+ + NFF
Sbjct: 238 CDALPVSLIGMNSRLMAQYIEFVADRMLTDLGYQAMYG-SKNPFDWM-DMISLEGKTNFF 295

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 296 EKRVGEYQKSG 306


>gi|219110949|ref|XP_002177226.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411761|gb|EEC51689.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 409

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 73/133 (54%), Gaps = 17/133 (12%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH----EATLLE 56
           M G+    + I RDE LH +F              L++K  ++ S T +H    EA  +E
Sbjct: 266 MPGLTFSNELISRDEGLHCSFAC-----------QLYSKLERKLSETDMHKLIGEAVEVE 314

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
             +  + +P G +G+NA    QY++F+A+R  H +G   L+  ++NPF WM ++I L+ +
Sbjct: 315 KGFVCDALPVGLIGMNASLMSQYVEFVADRLLHDLGYRTLYG-SKNPFDWM-DMISLEGK 372

Query: 117 KNFFETRVTEYQQ 129
            NFFE RV EYQ+
Sbjct: 373 TNFFEKRVGEYQK 385


>gi|15229476|ref|NP_189000.1| RNR2A (RIBONUCLEOTIDE REDUCTASE 2A); ribonucleoside-diphosphate
           reductase [Arabidopsis thaliana]
 gi|27735240|sp|P50651|RIR2A_ARATH RecName: Full=Ribonucleoside-diphosphate reductase small chain A;
           AltName: Full=Ribonucleoside-diphosphate reductase R2A
           subunit; Short=AtRNR2; Short=Protein R2at; AltName:
           Full=Ribonucleotide reductase small subunit A
 gi|13937232|gb|AAK50108.1|AF372971_1 AT3g23580/MDB19_7 [Arabidopsis thaliana]
 gi|9294514|dbj|BAB02776.1| ribonucleotide reductase [Arabidopsis thaliana]
 gi|23505945|gb|AAN28832.1| At3g23580/MDB19_7 [Arabidopsis thaliana]
          Length = 341

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++ + P        +K   ++HEA  +E  + 
Sbjct: 200 MPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPL-------EKVYQIVHEAVEIETEFV 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY+QF+A+R    +G E  +K  ENPF WM E I L+ + NFF
Sbjct: 253 CKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERTYK-AENPFDWM-EFISLQGKTNFF 310

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 311 EKRVGEYQKAS 321


>gi|257067181|ref|YP_003153437.1| ribonucleotide-diphosphate reductase subunit beta [Anaerococcus
           prevotii DSM 20548]
 gi|256799061|gb|ACV29716.1| Ribonucleoside-diphosphate reductase [Anaerococcus prevotii DSM
           20548]
          Length = 352

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN +K E   L+  E Q   R ML E    EIA+ 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSLINDLKKEREDLFVPELQNYYREMLKEGVEQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
             ++     GLN    E Y++++ N R   +GLEPL++ Y E P    W+ E  D    K
Sbjct: 272 KYSIGNSIAGLNEKMIEDYIKYLGNLRAKGLGLEPLYEGYKEIPESMKWVDEYSDPNGVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +VT Y + + ++ D
Sbjct: 332 TDFFEAKVTAYSKSSIIEDD 351


>gi|297831106|ref|XP_002883435.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
 gi|297329275|gb|EFH59694.1| RNR2/RNR2A [Arabidopsis lyrata subsp. lyrata]
          Length = 341

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++ + P        +K   ++HEA  +E  + 
Sbjct: 200 MPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPL-------EKVYQIVHEAVEIETEFV 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY+QF+A+R    +G E  +K  ENPF WM E I L+ + NFF
Sbjct: 253 CKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERRYK-AENPFDWM-EFISLQGKTNFF 310

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 311 EKRVGEYQKAS 321


>gi|118443949|ref|YP_878438.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           novyi NT]
 gi|118134405|gb|ABK61449.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           novyi NT]
          Length = 342

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 74/138 (53%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K ENP ++T+   ++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEITHLILFQNIIKELKNENPDIFTESIMEEFRMMMKMGVEHEIKWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    E+Y+++++N R + IGLE L+ + TE+P  W+     L   K +
Sbjct: 262 QYVTNNEILGINDNLIEKYIKYLSNLRLNAIGLEVLYPEITEHPMEWIENFSKLNNTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|326792202|ref|YP_004310023.1| ribonucleotide reductase [Clostridium lentocellum DSM 5427]
 gi|326542966|gb|ADZ84825.1| ribonucleotide reductase [Clostridium lentocellum DSM 5427]
          Length = 342

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K ENP L+T+   ++ R M+      EIA+ 
Sbjct: 202 MTATSTIFKYINRDEITHLVVFQNIIKELKKENPELFTESMIEEFREMMRVGVEHEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    + Y+++++N+R   IGLE L+ + T +P  W+     L   K +
Sbjct: 262 QYVTANEIMGINDQLIDAYIKYLSNQRLKAIGLEELYPEITTHPMAWIDSFSKLNNTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|227498392|ref|ZP_03928542.1| ribonucleoside-diphosphate reductase [Acidaminococcus sp. D21]
 gi|226903854|gb|EEH89772.1| ribonucleoside-diphosphate reductase [Acidaminococcus sp. D21]
          Length = 342

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    +++ +++ E P L+TKE       M+ +    EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLILFQNILRELRHERPDLFTKEQDAHIADMIRQGAENEIKWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    E+Y++++AN R   IGL PL+ + ++NP  W+    +L   K +
Sbjct: 262 QYITDDKILGLNNGLIEKYIKYLANIRLEAIGLAPLYPEISQNPMEWIESFSNLNGTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|227485717|ref|ZP_03916033.1| ribonucleoside-diphosphate reductase [Anaerococcus lactolyticus
           ATCC 51172]
 gi|227236272|gb|EEI86287.1| ribonucleoside-diphosphate reductase [Anaerococcus lactolyticus
           ATCC 51172]
          Length = 352

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN +K E P L+T E     R ML E    EI + 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSLINDLKKERPDLFTPEATIVYRDMLKEGVRQEIEWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL+    E Y++++ N R   +G +PLF+ YTE P    W+ E  D  + K
Sbjct: 272 KYAIGDNIAGLSTTMIEDYIKYLGNLRAKGLGFDPLFEGYTEIPQSMKWVDEYSDPNRVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +VT Y + + ++ D
Sbjct: 332 TDFFEAKVTAYSKSSIIEDD 351


>gi|224438210|ref|ZP_03659145.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
 gi|313144656|ref|ZP_07806849.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
 gi|313129687|gb|EFR47304.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           cinaedi CCUG 18818]
          Length = 348

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL     +IN ++ E PHL+T   +++   M  +A  +E  + 
Sbjct: 212 MLGSAQMIRFIQRDEVTHLLVFQQMINALRKEQPHLFTPSLEEEVIAMFQKAVEIESVWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL A    +Y+Q++A+ R   +GL  ++ +++NP  W+ +      +K NF
Sbjct: 272 EYITQGQILGLTAEIIREYIQYLADMRLRAVGLREIY-HSKNPIKWVEQFASFNDQKTNF 330

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 331 FEAKVTNYSKGS 342


>gi|225012154|ref|ZP_03702591.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
 gi|225003709|gb|EEG41682.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-2A]
          Length = 325

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 73/133 (54%), Gaps = 8/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K    + + +L +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGVHCDFAV------HLHNHHLVNKVPPARIKEILLDALTIEREFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++GLE  F  T NPF +M ++I L+ + NFF
Sbjct: 240 TESLPISLIGMNAKLMTQYLEFVTDRLLQELGLEKEFNVT-NPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGL 133
           E RV EYQ+   L
Sbjct: 298 EKRVGEYQKAGVL 310


>gi|257456224|ref|ZP_05621421.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           vincentii ATCC 35580]
 gi|257446310|gb|EEV21356.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           vincentii ATCC 35580]
          Length = 351

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I++++ E P L+T E  +  R+M+ E    EIA+ 
Sbjct: 211 MPGSVQEIRYINRDENTHLWLFRSIIHELQKEEPQLFTPENNELFRSMIREGCEQEIAWG 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           H  +     GL       Y+Q++ N RC  +G EPL++ + E P    W+S+  +    K
Sbjct: 271 HYVIGDDIPGLTRGMVTDYIQYLGNLRCENLGFEPLYEGHREEPASMSWVSQYSNANLIK 330

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y + + LK D
Sbjct: 331 TDFFEAKSTAYAKSSALKDD 350


>gi|254374389|ref|ZP_04989871.1| glutaredoxin [Francisella novicida GA99-3548]
 gi|151572109|gb|EDN37763.1| glutaredoxin [Francisella novicida GA99-3548]
          Length = 410

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDKFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|118497575|ref|YP_898625.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. novicida
           U112]
 gi|195536272|ref|ZP_03079279.1| ribonucleoside-diphosphate reductase, beta subunit domain
           [Francisella tularensis subsp. novicida FTE]
 gi|208779374|ref|ZP_03246720.1| ribonucleoside-diphosphate reductase, beta subunit domain
           [Francisella novicida FTG]
 gi|254372936|ref|ZP_04988425.1| hypothetical protein FTCG_00507 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|118423481|gb|ABK89871.1| bifunctional protein: glutaredoxin 3 /ribonucleotide reductase beta
           subunit [Francisella novicida U112]
 gi|151570663|gb|EDN36317.1| hypothetical protein FTCG_00507 [Francisella novicida GA99-3549]
 gi|194372749|gb|EDX27460.1| ribonucleoside-diphosphate reductase, beta subunit domain
           [Francisella tularensis subsp. novicida FTE]
 gi|208745174|gb|EDZ91472.1| ribonucleoside-diphosphate reductase, beta subunit domain
           [Francisella novicida FTG]
          Length = 410

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDKFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|325478871|gb|EGC81981.1| ribonucleoside-diphosphate reductase, beta subunit [Anaerococcus
           prevotii ACS-065-V-Col13]
          Length = 352

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN ++ E   L+TKE ++  R ML E    EIA+ 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSLINDLRKEREDLFTKEHKEYYRNMLKEGVEQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL+    E Y++++ N R   +GLE L++ YTE P    W+ E  D    K
Sbjct: 272 KYAIGDNIAGLSEKMIEDYIKYLGNLRAKGLGLEALYEGYTEIPDSMKWVDEYSDPNAVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +VT Y + + ++ D
Sbjct: 332 TDFFEAKVTAYSKSSIIEDD 351


>gi|212723480|ref|NP_001131892.1| hypothetical protein LOC100193273 [Zea mays]
 gi|194692834|gb|ACF80501.1| unknown [Zea mays]
 gi|195624040|gb|ACG33850.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++       +K  + + RT++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYDVLR-------SKLDEARVRTIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++  T NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVSLVGMNGDLMSQYIEFVADRLLMALGCKKMYNVT-NPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 308 EKRVGDYQKAS 318


>gi|89256330|ref|YP_513692.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314778|ref|YP_763501.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502403|ref|YP_001428469.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010840|ref|ZP_02275771.1| ribonucleotide-diphosphate reductase beta subunit [Francisella
           tularensis subsp. holarctica FSC200]
 gi|254367665|ref|ZP_04983686.1| biofunctional protein: glutaredoxin 3
           protein-ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. holarctica 257]
 gi|290952877|ref|ZP_06557498.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313922|ref|ZP_06804487.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. holarctica
           URFT1]
 gi|89144161|emb|CAJ79423.1| Biofunctional protein, glutaredoxin 3
           protein/Ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. holarctica LVS]
 gi|115129677|gb|ABI82864.1| ribonucleoside-diphosphate reductase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253476|gb|EBA52570.1| biofunctional protein: glutaredoxin 3
           protein-ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. holarctica 257]
 gi|156253006|gb|ABU61512.1| bifunctional glutaredoxin /ribonucleoside-diphosphate reductase
           beta subunit [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 410

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|56707665|ref|YP_169561.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670136|ref|YP_666693.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. tularensis
           FSC198]
 gi|187931834|ref|YP_001891819.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|224456732|ref|ZP_03665205.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370173|ref|ZP_04986179.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874478|ref|ZP_05247188.1| nrdB, biofunctional protein, glutaredoxin 3
           protein/ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604157|emb|CAG45165.1| Biofunctional protein, glutaredoxin 3
           protein/Ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. tularensis SCHU
           S4]
 gi|110320469|emb|CAL08548.1| Biofunctional protein, glutaredoxin 3
           protein/Ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151568417|gb|EDN34071.1| hypothetical protein FTBG_01287 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|187712743|gb|ACD31040.1| bifunctional protein: glutaredoxin 3/ribonucleotide reductase beta
           subunit [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|254840477|gb|EET18913.1| nrdB, biofunctional protein, glutaredoxin 3
           protein/ribonucleoside-diphosphate reductase, beta
           subunit [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282158827|gb|ADA78218.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 410

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|254369307|ref|ZP_04985319.1| hypothetical protein FTAG_00272 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157122257|gb|EDO66397.1| hypothetical protein FTAG_00272 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 410

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|134301991|ref|YP_001121960.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134049768|gb|ABO46839.1| biofunctional glutaredoxin 3 protein/Ribonucleoside-diphosphate
           reductase beta subunit [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 410

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|189184364|ref|YP_001938149.1| ribonucleotide-diphosphate reductase subunit beta [Orientia
           tsutsugamushi str. Ikeda]
 gi|189181135|dbj|BAG40915.1| ribonucleoside-diphosphate reductase beta chain [Orientia
           tsutsugamushi str. Ikeda]
          Length = 359

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 14/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSR------TMLH-EAT 53
           M G+ +   + +RDE+LH N  I +      E P +WT+  Q KSR      T++H E  
Sbjct: 193 MKGMGQIITWSVRDETLHTNSIITLFKTFIQEYPEVWTE--QLKSRIYEACCTIIHFEDA 250

Query: 54  LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 113
            +++A+       G  GL A   ++Y+++IA+RR  Q+GL+  +   +NP  W+ ++++ 
Sbjct: 251 FIDLAFE----VGGVEGLEARDVKKYIRYIADRRLLQLGLKENYLIEQNPLTWLDQILNG 306

Query: 114 KKEKNFFETRVTEYQQGAGL-KWD 136
            +  NFFE RVTEY + A    WD
Sbjct: 307 VEHTNFFENRVTEYTRSATTGSWD 330


>gi|57339646|gb|AAW49810.1| hypothetical protein FTT0532 [synthetic construct]
          Length = 445

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   EF+++   M  +A  LE  + 
Sbjct: 294 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNEFKKEIYLMASKAVELEDRFI 353

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 354 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 413

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 414 FENRVTEYEV-AGLTGSWD 431


>gi|148284015|ref|YP_001248105.1| ribonucleotide-diphosphate reductase subunit beta [Orientia
           tsutsugamushi str. Boryong]
 gi|146739454|emb|CAM79093.1| ribonucleoside-diphosphate reductase beta chain [Orientia
           tsutsugamushi str. Boryong]
          Length = 329

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 79/144 (54%), Gaps = 14/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSR------TMLH-EAT 53
           M G+ +   + +RDE+LH N  I +      E P +WT+  Q KSR      T++H E  
Sbjct: 178 MKGMGQIITWSVRDETLHTNSIITLFKTFIQEYPEVWTE--QLKSRIYEACCTIIHFEDA 235

Query: 54  LLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDL 113
            +++A+       G  GL A   ++Y+++IA+RR  Q+GL+  +   +NP  W+ ++++ 
Sbjct: 236 FIDLAFE----VGGVEGLEARDVKKYIRYIADRRLLQLGLKENYLIEQNPLTWLDQILNG 291

Query: 114 KKEKNFFETRVTEYQQGAGL-KWD 136
            +  NFFE RVTEY + A    WD
Sbjct: 292 VEHTNFFENRVTEYTRSATTGSWD 315


>gi|163753569|ref|ZP_02160692.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
 gi|161325783|gb|EDP97109.1| ribonucleoside-diphosphate reductase 1, beta subunit [Kordia
           algicida OT-1]
          Length = 326

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 75/133 (56%), Gaps = 8/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++ R ++ +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGVHCDFAV------HLHNNHLVNKVPKERIRAIIVDALNIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++G E  +  + NPF +M ++I L+ + NFF
Sbjct: 241 TESLPVSLIGMNAKLMTQYLEFVTDRLLQELGCEKEYNVS-NPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGL 133
           E RV+EYQ+   L
Sbjct: 299 EKRVSEYQKAGVL 311


>gi|289548460|ref|YP_003473448.1| ribonucleoside-diphosphate reductase [Thermocrinis albus DSM 14484]
 gi|289182077|gb|ADC89321.1| Ribonucleoside-diphosphate reductase [Thermocrinis albus DSM 14484]
          Length = 342

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 2/137 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+   +Q +YI RDE  H++   ++I  +K ENP L+T E ++  +     A   EI + 
Sbjct: 206 MLSTVQQIKYINRDELTHVSLFRNIILTLKKENPELFTPEMEKWVKEFFRYAASEEIKWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    ++Y++++AN R  QIG EP+F   TENP  W+     +   K +
Sbjct: 266 QYVTRNQILGINDQLIDRYIKYLANLRLTQIGYEPVFPDVTENPMKWIDTFRTINDTKTD 325

Query: 119 FFETRVTEYQQGAGLKW 135
           FF+ +   Y + + LKW
Sbjct: 326 FFQAKPQTYAKRSELKW 342


>gi|218289144|ref|ZP_03493380.1| Ribonucleoside-diphosphate reductase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240727|gb|EED07906.1| Ribonucleoside-diphosphate reductase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 345

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G   + ++I RDE  HL    ++ ++I  ENP + T + +++   M+  A   EIA+ 
Sbjct: 206 MLGTVSEIKFIQRDELTHLAIFRNLYHEIVRENPGIVTPDMEEEFVEMMRTAVQHEIAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   VGL     + Y++++AN R   + L  L+ +  E+P PWM     +   K +
Sbjct: 266 QYVTQGKIVGLTDALIDAYIKYLANLRLQSLNLPILYPEIKEHPMPWMDSFAAINSHKTD 325

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE RVT Y +   L WD
Sbjct: 326 FFEQRVTNYTKAGNLNWD 343


>gi|330814259|ref|YP_004358498.1| ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487354|gb|AEA81759.1| ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 345

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT----KEFQQKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I + N    ENP L      KE  +   T++ HE   +
Sbjct: 201 MKGMGQIVTWSVRDETLHCNSMIKIFNTFCDENPGLLDDSLKKEIYEACSTIIEHEDAFI 260

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    +     GL A   ++Y+++IANRR  Q+ L  L++  ENP  W+ ++++  +
Sbjct: 261 DLAFEMGDIE----GLKAEEVKKYIRWIANRRLAQLRLNDLYEVKENPLTWLDDMLNGVE 316

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 317 HMNFFEGRATEYSKAS 332


>gi|262277047|ref|ZP_06054840.1| ribonucleoside-diphosphate reductase, beta subunit [alpha
           proteobacterium HIMB114]
 gi|262224150|gb|EEY74609.1| ribonucleoside-diphosphate reductase, beta subunit [alpha
           proteobacterium HIMB114]
          Length = 342

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 73/136 (53%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWT----KEFQQKSRTML-HEATLL 55
           M G+ +   + +RDE+LH N  I + N    ENP L      KE     RT++ HE   +
Sbjct: 198 MKGMGQVVTWSVRDETLHCNSMIKIFNTFCAENPGLLDESLKKEITDACRTIVEHEDAFI 257

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+  E  P    GL A   + Y+++IANRR  Q+ L+ ++   ENP  W+  +++  +
Sbjct: 258 DLAF--EMGP--IEGLTAQQIKDYIRWIANRRLVQLKLDEIYDVKENPLEWIDTMLNGVE 313

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE R TEY + +
Sbjct: 314 HMNFFEGRATEYSKAS 329


>gi|258511567|ref|YP_003185001.1| Ribonucleoside-diphosphate reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478293|gb|ACV58612.1| Ribonucleoside-diphosphate reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 369

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G   + ++I RDE  HL    ++ ++I  ENP + T + +++   M+  A   EIA+ 
Sbjct: 230 MLGTVSEIKFIQRDELTHLAIFRNLYHEIIRENPGIVTPDMEEEFVEMMRTAVQHEIAWG 289

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   VGL     + Y++++AN R   + L  L+ +  E+P PWM     +   K +
Sbjct: 290 QYVTQGKIVGLTDALIDAYIKYLANLRLQSLNLPILYPEIKEHPMPWMDSFAAINSHKTD 349

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE RVT Y +   L WD
Sbjct: 350 FFEQRVTNYTKAGNLNWD 367


>gi|330941351|gb|EGH44203.1| ribonucleotide-diphosphate reductase subunit beta [Pseudomonas
           syringae pv. pisi str. 1704B]
          Length = 317

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 36/37 (97%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLW 37
           M G+AEQ+QYI+RDES+HLNFGIDVINQIKIENPHLW
Sbjct: 280 MTGVAEQFQYILRDESMHLNFGIDVINQIKIENPHLW 316


>gi|148676854|gb|EDL08801.1| ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus]
          Length = 297

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  + + R ++ +A  +E  + 
Sbjct: 160 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEDRVREIIADAVQIEQEFL 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 213 TEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQ-AENPFDFM-ENISLEGKTNFF 270

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 271 EKRVSEYQRFA 281


>gi|195953600|ref|YP_002121890.1| Ribonucleoside-diphosphate reductase [Hydrogenobaculum sp. Y04AAS1]
 gi|195933212|gb|ACG57912.1| Ribonucleoside-diphosphate reductase [Hydrogenobaculum sp. Y04AAS1]
          Length = 319

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 73/123 (59%), Gaps = 6/123 (4%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQI-KIENPHLWTKEFQQKSRTMLHEATLLEIAYAH 61
            +A   ++I++DE+ HL FGI ++N++ K +N +    +++ K R ++ EA  +E  YA 
Sbjct: 200 NVAALVRWILKDETRHLAFGIYLLNELLKDKNKN----DYKDKFRVLMEEAVDIETEYAR 255

Query: 62  ETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFE 121
             MP+  +GL+  +   Y++++A+RR   +G + ++   +NP  W++   DL    NFFE
Sbjct: 256 VAMPEKIIGLSFETYTSYVKYLADRRMRSLGFDAIYG-QKNPMKWLTTQTDLPDLTNFFE 314

Query: 122 TRV 124
            +V
Sbjct: 315 AKV 317


>gi|41054952|ref|NP_955770.1| ribonucleoside-diphosphate reductase subunit M2 B [Mus musculus]
 gi|81885688|sp|Q6PEE3|RIR2B_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|34786000|gb|AAH58103.1| Ribonucleotide reductase M2 B (TP53 inducible) [Mus musculus]
 gi|74218244|dbj|BAE23760.1| unnamed protein product [Mus musculus]
          Length = 351

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  + + R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEDRVREIIADAVQIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|288817346|ref|YP_003431693.1| ribonucleotide reductase beta subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|288786745|dbj|BAI68492.1| ribonucleotide reductase beta subunit [Hydrogenobacter thermophilus
           TK-6]
 gi|308750953|gb|ADO44436.1| ribonucleotide reductase [Hydrogenobacter thermophilus TK-6]
          Length = 342

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 2/137 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M    +Q +YI RDE  H+    ++I  IK ENP L+T E ++        AT  EI + 
Sbjct: 206 MRNTVQQIKYINRDELTHVTLFRNIIQTIKQENPELFTPELEKWVYEFFKYATDAEIKWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    ++Y++++AN R  Q+G +PL+ + TENP  W+ +   +   K +
Sbjct: 266 QYVTQNQILGINNTLIDRYIKYLANLRLTQLGYKPLYPEITENPMKWIDQFRTINDTKTD 325

Query: 119 FFETRVTEYQQGAGLKW 135
           FF+ +   Y + + LKW
Sbjct: 326 FFQAKPQTYAKRSELKW 342


>gi|114799612|ref|YP_759103.1| ribonucleotide-diphosphate reductase subunit beta [Hyphomonas
           neptunium ATCC 15444]
 gi|114739786|gb|ABI77911.1| ribonucleoside-diphosphate reductase, beta subunit [Hyphomonas
           neptunium ATCC 15444]
          Length = 345

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + +    E   + T E +++ R        LE  + 
Sbjct: 186 MKGMGQIVTWSIRDESLHCEGMIKLFHSFCAETGVM-TDELRERIRDCCRTVVALEDKFI 244

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+ A   + Y+++IA+ R +Q+ LEP++  T++P PW++E+++  +  NF
Sbjct: 245 ELAFEMGPVEGMTADDIKNYIRYIADWRLNQLKLEPIYGVTKHPIPWLTEILNGVEHANF 304

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 305 FEQRSTEYSKGA 316


>gi|146298285|ref|YP_001192876.1| ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
 gi|146152703|gb|ABQ03557.1| Ribonucleoside-diphosphate reductase [Flavobacterium johnsoniae
           UW101]
          Length = 325

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 77/136 (56%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++ + ++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGVHCDFAV------HLHNHHLVNKVPKERIKEIIVDALDIERQFV 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+A+R   ++G E ++  + NPF +M ++I L+ + NFF
Sbjct: 240 TESLPVSLIGMNAGLMTQYLEFVADRLLVELGCERVYG-SANPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+   +  D
Sbjct: 298 EKRVAEYQKSGVMNTD 313


>gi|150024561|ref|YP_001295387.1| ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
 gi|149771102|emb|CAL42569.1| Ribonucleoside-diphosphate reductase, beta subunit [Flavobacterium
           psychrophilum JIP02/86]
          Length = 325

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 77/136 (56%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++ R+++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGVHCDFAV------HLHNHHLVNKVPKERIRSIIVDALNIEREFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+A+R   ++G +  +  T NPF +M ++I L+ + NFF
Sbjct: 240 TESLPVSLIGMNAVLMTQYLEFVADRLLVELGCDREYN-TANPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E +V EYQ+   +  D
Sbjct: 298 EKKVAEYQKAGVMNTD 313


>gi|239502693|ref|ZP_04662003.1| ribonucleotide-diphosphate reductase subunit beta [Acinetobacter
           baumannii AB900]
          Length = 309

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 78/139 (56%), Gaps = 8/139 (5%)

Query: 1   MVGIAEQYQYIMRDE-SLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M+G A+  +YI RDE   HL+    +++ ++ EN  ++T+ F  K+  +   ++ +EI++
Sbjct: 175 MLGSADMIRYIQRDEEGTHLDLFAHMLDTLRHENKDVFTQSFWNKALEVFLTSSEMEISW 234

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY--TENPFPWMSEVIDLK-KE 116
             + + KG    N  + E Y++ +AN R  QI   P   Y   +NPFPW+ +       E
Sbjct: 235 G-KYITKGVT--NPKAIEDYIKHLANLRAEQIQ-APFVPYPGVKNPFPWVEQFSKPNTSE 290

Query: 117 KNFFETRVTEYQQGAGLKW 135
           KNFFETRVT+Y+ G  L W
Sbjct: 291 KNFFETRVTDYKVGGALVW 309


>gi|322510876|gb|ADX06189.1| putative ribonucleotide reductase small subunit [Organic Lake
           phycodnavirus 2]
          Length = 324

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 76/128 (59%), Gaps = 9/128 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE+LH  F + + N+++        K  ++K R ++ EA  +E  + 
Sbjct: 189 MPGLTFSNELISRDEALHTEFAVYLYNRLE-------KKLNKKKVREIIEEAVTIEKEFI 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R   Q+G + ++  T NPF +M E+I L+++ NFF
Sbjct: 242 VDALPCRMIGMNSELMTQYIEFVADRLMMQLGCDVIYA-TNNPFDFM-ELISLEQKTNFF 299

Query: 121 ETRVTEYQ 128
           E+RV+EY 
Sbjct: 300 ESRVSEYS 307


>gi|332184137|gb|AEE26391.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Francisella cf. novicida 3523]
          Length = 410

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   +F+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAVELEDKFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   +QY++ I +RR +Q+GL+ ++   +NP  W+  +++     NF
Sbjct: 328 ELAYELGTIEGLKADEVKQYIRHITDRRLNQLGLKEIYNIEKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGSWD 405


>gi|75076588|sp|Q4R741|RIR2B_MACFA RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|67969468|dbj|BAE01083.1| unnamed protein product [Macaca fascicularis]
          Length = 351

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVQIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKIFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|160881347|ref|YP_001560315.1| ribonucleoside-diphosphate reductase [Clostridium phytofermentans
           ISDg]
 gi|160430013|gb|ABX43576.1| Ribonucleoside-diphosphate reductase [Clostridium phytofermentans
           ISDg]
          Length = 342

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    +++ ++++E   ++TK  +++ R M+      EIA+ 
Sbjct: 202 MTATSTIFKYINRDEITHLVLFQNIMKELRVEQKEMFTKGLEEELREMMRTGVEHEIAWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    +QY+++++N+R   +GLE L+ + T++P  W+    ++   K +
Sbjct: 262 QYVTDNQILGINNELIDQYIKYLSNQRLRAVGLEILYPEITKHPMEWIESFSNINSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAVFDFD 339


>gi|289177076|ref|NP_001165949.1| ribonucleoside-diphosphate reductase subunit M2 B isoform 3 [Homo
           sapiens]
 gi|55631160|ref|XP_528204.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) isoform 3
           [Pan troglodytes]
 gi|42794058|dbj|BAD11774.1| p53-inducible ribonucleotide reductase small subunit 2 long form
           [Homo sapiens]
 gi|119612246|gb|EAW91840.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_a [Homo
           sapiens]
          Length = 299

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 162 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 214

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 215 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 272

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 273 EKRVSEYQRFA 283


>gi|189501948|ref|YP_001957665.1| hypothetical protein Aasi_0535 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189497389|gb|ACE05936.1| hypothetical protein Aasi_0535 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 355

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 74/134 (55%), Gaps = 8/134 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   +         HL  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLSFSNELISRDEGLHCDFACLLYAN------HLQNKLPEERVREIITDAVAIEKEFV 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R   ++G   ++  T NPF +M E+I L+ + NFF
Sbjct: 268 TDALPVKLIGMNADLMSQYIEFVADRLLLELGCSKVYNAT-NPFDFM-EMISLQGKTNFF 325

Query: 121 ETRVTEYQQGAGLK 134
           E RV EYQ+   +K
Sbjct: 326 EKRVGEYQKAGVMK 339


>gi|27769295|gb|AAH42468.1| Similar to ribonucleotide reductase M2 polypeptide [Homo sapiens]
          Length = 285

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 148 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 200

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 201 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 258

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 259 EKRVSEYQRFA 269


>gi|42544136|ref|NP_056528.2| ribonucleoside-diphosphate reductase subunit M2 B isoform 1 [Homo
           sapiens]
 gi|114621161|ref|XP_001153916.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) isoform 2
           [Pan troglodytes]
 gi|74727333|sp|Q7LG56|RIR2B_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B;
           AltName: Full=TP53-inducible ribonucleotide reductase M2
           B; AltName: Full=p53-inducible ribonucleotide reductase
           small subunit 2-like protein; Short=p53R2
 gi|261278726|pdb|3HF1|A Chain A, Crystal Structure Of Human P53r2
 gi|261278727|pdb|3HF1|B Chain B, Crystal Structure Of Human P53r2
 gi|7229086|dbj|BAA92434.1| ribonucleotide reductase [Homo sapiens]
 gi|7229115|dbj|BAA92493.1| ribonucleotide reductase [Homo sapiens]
 gi|45259569|dbj|BAD12267.1| p53-inducible ribonucleotide reductase small subunit 2 [Homo
           sapiens]
 gi|52545612|emb|CAB70703.2| hypothetical protein [Homo sapiens]
 gi|63055293|gb|AAY29059.1| ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|80473666|gb|AAI08262.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|109659128|gb|AAI17497.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|119612247|gb|EAW91841.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_b [Homo
           sapiens]
 gi|120660296|gb|AAI30629.1| Ribonucleotide reductase M2 B (TP53 inducible) [Homo sapiens]
 gi|190689549|gb|ACE86549.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|190690911|gb|ACE87230.1| ribonucleotide reductase M2 B (TP53 inducible) protein [synthetic
           construct]
 gi|261859014|dbj|BAI46029.1| ribonucleotide reductase M2 B [synthetic construct]
 gi|313882916|gb|ADR82944.1| ribonucleotide reductase M2 B (TP53 inducible) [synthetic
           construct]
          Length = 351

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|197101489|ref|NP_001125944.1| ribonucleoside-diphosphate reductase subunit M2 B [Pongo abelii]
 gi|75041724|sp|Q5R9G0|RIR2B_PONAB RecName: Full=Ribonucleoside-diphosphate reductase subunit M2 B
 gi|55729743|emb|CAH91600.1| hypothetical protein [Pongo abelii]
          Length = 351

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|114621164|ref|XP_001153859.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
 gi|119612248|gb|EAW91842.1| ribonucleotide reductase M2 B (TP53 inducible), isoform CRA_c [Homo
           sapiens]
 gi|194385642|dbj|BAG65196.1| unnamed protein product [Homo sapiens]
          Length = 297

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 160 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 213 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 270

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 271 EKRVSEYQRFA 281


>gi|296227442|ref|XP_002759378.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           isoform 2 [Callithrix jacchus]
          Length = 299

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 162 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 214

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G    F+  ENPF +M E I L+ + NFF
Sbjct: 215 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKFFQ-AENPFDFM-ENISLEGKTNFF 272

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 273 EKRVSEYQRFA 283


>gi|7023557|dbj|BAA92005.1| unnamed protein product [Homo sapiens]
          Length = 351

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGVNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|118474076|ref|YP_891239.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           fetus subsp. fetus 82-40]
 gi|118413302|gb|ABK81722.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           fetus subsp. fetus 82-40]
          Length = 340

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T E + K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFTSEVEAKIYEMFKKAGDLEIEWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ + R   IGL+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITGNQIMGFTDDIIEEYIHYLVDDRLTSIGLKKLYN-AKHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|319942042|ref|ZP_08016361.1| ribonucleoside-diphosphate reductase subunit beta [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804426|gb|EFW01304.1| ribonucleoside-diphosphate reductase subunit beta [Sutterella
           wadsworthensis 3_1_45B]
          Length = 344

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 70/136 (51%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + + DE+LH      +  +   ENP LWT E + K    +  M+  E   +
Sbjct: 200 MKGMGQIIAWSIADETLHTESMTKIFREYITENPELWTDELKAKIYGIAEVMVDLEDKFI 259

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M +    L       Y+++IA+RR   +GL+ +FK T NP PW+  ++ +  
Sbjct: 260 DLAFGVSEMKR----LTREDVRSYIRYIADRRLMGLGLKGIFKSTTNPLPWVDAMLGV-T 314

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RV +Y +GA
Sbjct: 315 HTNFFENRVVDYAKGA 330


>gi|86134368|ref|ZP_01052950.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
 gi|85821231|gb|EAQ42378.1| ribonucleoside-diphosphate reductase small chain [Polaribacter sp.
           MED152]
          Length = 323

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 76/132 (57%), Gaps = 9/132 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE +H +F +       + N H+  +  + + + ++ +A  +E  +  E
Sbjct: 188 GLTFSNELISRDEGMHCDFAV------HLHNNHIVNRVPKDRIKEIIVDALDIEREFVTE 241

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+NA    QY++F+ +R   + G E ++  T NPF +M E+I L+ + NFFE 
Sbjct: 242 SLPVSLIGMNAKLMTQYLEFVTDRLLLEFGCEKVYDVT-NPFDFM-EMISLEGKTNFFEK 299

Query: 123 RVTEYQQGAGLK 134
           RV+EYQ+ AG+K
Sbjct: 300 RVSEYQK-AGVK 310


>gi|296227440|ref|XP_002759377.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           isoform 1 [Callithrix jacchus]
          Length = 351

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G    F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKFFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|256081213|ref|XP_002576867.1| ribonucleoside-diphosphate reductase small chain [Schistosoma
           mansoni]
 gi|238662153|emb|CAZ33104.1| ribonucleoside-diphosphate reductase small chain, putative
           [Schistosoma mansoni]
          Length = 365

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   +   I  + P       +++  +++ EA L+E  + 
Sbjct: 225 MPGLSFSNELISRDEGLHCDFACLLFKHIIKKPP-------KERVESIIREAVLIEQEFL 277

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++FIA+R   ++G E ++ +++NPF +M E I ++ + NFF
Sbjct: 278 SEALPVSLIGMNCKLMCQYIEFIADRLLVELGYEKMY-HSDNPFDFM-ENISIEGKTNFF 335

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 336 EKRVGEYQRAG 346


>gi|34482564|emb|CAE09564.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE BETA CHAIN [Wolinella
           succinogenes]
          Length = 283

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +K E P L+TK  +++   M  +A  +E A+ 
Sbjct: 147 MLGSAQMIRFIQRDEVTHLLIFQNMINALKKERPDLFTKSLEEEVVEMFRKAVAVESAWG 206

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +    +Y+Q++A+ R  ++G+ P+    ++P  W+ +     ++K NF
Sbjct: 207 DYITQGQILGLTSEIIHEYIQYLADDRLKRVGM-PILYNAKHPIKWVDQFSSFNEQKTNF 265

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 266 FEGNVTNYAKGS 277


>gi|296271635|ref|YP_003654266.1| ribonucleoside-diphosphate reductase [Arcobacter nitrofigilis DSM
           7299]
 gi|296095810|gb|ADG91760.1| Ribonucleoside-diphosphate reductase [Arcobacter nitrofigilis DSM
           7299]
          Length = 339

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  ++I RDE  HL    ++IN  + E P L+T E + K R M  +A  LE A+ 
Sbjct: 203 MLGSSQMIKFIQRDEVTHLLLFQNMINSTRKERPDLFTPELEVKVRAMFRKAVELEAAWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G       QY+Q++A++R   +G +P +   ++P PW+        ++ NF
Sbjct: 263 AYITQGQILGFTDGIITQYIQYLADKRLDAVGYKPEYN-VKHPIPWVDGYSSFNDQRTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  V  Y +G+
Sbjct: 322 FEGNVVNYSKGS 333


>gi|161760549|ref|NP_906664.2| ribonucleotide-diphosphate reductase subunit beta [Wolinella
           succinogenes DSM 1740]
          Length = 341

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +K E P L+TK  +++   M  +A  +E A+ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLLIFQNMINALKKERPDLFTKSLEEEVVEMFRKAVAVESAWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +    +Y+Q++A+ R  ++G+ P+    ++P  W+ +     ++K NF
Sbjct: 265 DYITQGQILGLTSEIIHEYIQYLADDRLKRVGM-PILYNAKHPIKWVDQFSSFNEQKTNF 323

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 324 FEGNVTNYAKGS 335


>gi|315452596|ref|YP_004072866.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter felis
           ATCC 49179]
 gi|315131648|emb|CBY82276.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter felis
           ATCC 49179]
          Length = 347

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL     +I+ +K E P L++K+  ++   M  EA  LE  + 
Sbjct: 211 MLGSAQMIRFIQRDEVTHLALFQSMIHTLKKERPDLFSKDLVEEILEMFKEAVDLESTWG 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   + LN  +   Y++++A+ R H IGL P   +T++P  W+ +      ++ NF
Sbjct: 271 RVITQGEILDLNPVTLRAYIEYLADTRLHAIGL-PKIYHTKHPMRWVDQFSSFNSQRSNF 329

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 330 FEARVSNYSKGS 341


>gi|289177074|ref|NP_001165948.1| ribonucleoside-diphosphate reductase subunit M2 B isoform 2 [Homo
           sapiens]
          Length = 423

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 286 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFL 338

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 339 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 396

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 397 EKRVSEYQRFA 407


>gi|301166951|emb|CBW26530.1| putative ribonucleoside-diphosphate reductase small chain subunit
           [Bacteriovorax marinus SJ]
          Length = 322

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTM---LHEATLLEI 57
           M G+    ++I RDE LH  F   +          L T E Q    T+   + EA  +E 
Sbjct: 183 MPGLCTSNEFISRDEGLHCEFACHI--------HELLTPEEQLNKETITQIITEAVSIEK 234

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P   +G+NA    +Y++F+A+   +++G E  +  TENPF WM E+I L+ + 
Sbjct: 235 EFITEAIPVSLIGMNADMMSRYIEFVADYWLNRLGCEKAYN-TENPFDWM-ELISLEGKT 292

Query: 118 NFFETRVTEYQQGAGL 133
           NFFE RV+EYQ+   L
Sbjct: 293 NFFEKRVSEYQKPGVL 308


>gi|255551489|ref|XP_002516790.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
 gi|223543878|gb|EEF45404.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
          Length = 342

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQ-QKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   + +        L  K+ Q QK + ++HEA  +E  +
Sbjct: 201 MPGLTFSNELISRDEGLHCDFACLLYS--------LLQKQLQWQKVQQIVHEAVEIETEF 252

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+N+    QY++F+A+R    +G +  +   ENPF WM E I L+ + NF
Sbjct: 253 VCDALPCALIGMNSTLMSQYIKFVADRLLVALGYQRKYN-VENPFDWM-EFISLQGKANF 310

Query: 120 FETRVTEYQQGA 131
           FE RV +YQ+ +
Sbjct: 311 FERRVGDYQKAS 322


>gi|327269406|ref|XP_003219485.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Anolis carolinensis]
          Length = 414

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 277 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 329

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 330 TEALPVGLIGMNCTLMKQYIEFVADRLLLELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 387

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 388 EKRVSEYQRFA 398


>gi|1710401|sp|P49730|RIR2_TOBAC RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleoside-diphosphate reductase R2
           subunit; AltName: Full=Ribonucleotide reductase small
           subunit
 gi|1044912|emb|CAA63194.1| ribonucleotide reductase R2 [Nicotiana tabacum]
          Length = 329

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++       TK  +++ + ++ +A  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------TKLTEERVKGIVADAVEIEREFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     +Y++F+A+R    +G + L+   +NPF WM E+I L+ + NFF
Sbjct: 241 CDALPCALVGMNGDLMSKYIEFVADRLLDALGYDKLYN-AQNPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 299 EKRVGEYQKAS 309


>gi|325181522|emb|CCA15972.1| ribonucleosidediphosphate reductase small chain put [Albugo
           laibachii Nc14]
          Length = 1611

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 74/133 (55%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +++  + P       +     ++ +A ++E  + 
Sbjct: 252 MPGLCFSNELISRDEGLHCDFACLMYSKLVNKLP-------EASIHAIISDAVVIEQEFV 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R  H +G+  L+ +T NPF WM ++I L+ + NFF
Sbjct: 305 RDSLPVELIGMNSSLMGQYIEFVADRLLHALGVSKLY-HTSNPFDWM-DMISLQGKTNFF 362

Query: 121 ETRVTEYQQGAGL 133
           E RV EY +   +
Sbjct: 363 EKRVGEYAKSGTI 375


>gi|241166485|ref|XP_002409876.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
 gi|215494664|gb|EEC04305.1| ribonucleotide reductase, beta subunit, putative [Ixodes
           scapularis]
          Length = 376

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  Q + R ++ +A ++E  + 
Sbjct: 239 MPGLTFSNELISRDEGLHTDFACLMFS-------HLVNKPSQARVRQIICDAVVIEQEFL 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    ++Y++F+A+R   ++G E ++  +ENPF +M E I L+ + NFF
Sbjct: 292 TDALPVALIGMNCELMKRYIEFVADRLLVELGCEKVYN-SENPFDFM-EHISLEGKTNFF 349

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 350 EKRVGEYQKAG 360


>gi|194673004|ref|XP_607398.4| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|297482473|ref|XP_002692807.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Bos
           taurus]
 gi|296480530|gb|DAA22645.1| ribonucleotide reductase M2 polypeptide-like [Bos taurus]
          Length = 351

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCVLMKQYIEFVADRLLTELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|50949848|emb|CAH10473.1| hypothetical protein [Homo sapiens]
          Length = 297

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++ +A  +E  + 
Sbjct: 160 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPPEERVREIIVDAVKIEQEFL 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 213 TEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 270

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 271 EKRVSEYQRFA 281


>gi|300676950|gb|ADK26821.1| ribonucleotide reductase M2 [Zonotrichia albicollis]
          Length = 390

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A L+E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIHKPSEERVREIIMNAVLIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIYK-AENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|291388369|ref|XP_002710634.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Oryctolagus cuniculus]
          Length = 339

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 202 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 254

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 255 TEALPVGLIGMNCILMKQYIEFVADRLLMELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 312

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 313 EKRVSEYQRFA 323


>gi|120437796|ref|YP_863482.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
 gi|117579946|emb|CAL68415.1| ribonucleoside-diphosphate reductase small chain [Gramella forsetii
           KT0803]
          Length = 325

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 77/136 (56%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F + + NQ      HL  +  ++K R +L +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGMHCDFAVHLHNQ------HLVNQVPKEKIREILIDALNIEREFV 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++  E  +  + NPF +M ++I+L+ + NFF
Sbjct: 240 TESLPVSLIGMNAKLMTQYLEFVTDRLLVELDCEKEYNVS-NPFDFM-DMINLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   +  D
Sbjct: 298 EKRVSEYQKAGVMNKD 313


>gi|290995765|ref|XP_002680453.1| predicted protein [Naegleria gruberi]
 gi|284094074|gb|EFC47709.1| predicted protein [Naegleria gruberi]
          Length = 338

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 74/130 (56%), Gaps = 8/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   + + +K      +TK  QQ   ++++EA  +E  + 
Sbjct: 200 MPGLSFSNELISRDEGLHTDFACLLYSTLK------YTKLPQQVVHSLVYEAVEIEKEFI 253

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+   +QY++ +A+R    IG E ++  + NPF WM+ +I +  + NFF
Sbjct: 254 SESLPVDLIGMNSRLMQQYIEMVADRLLVSIGYEKIYN-SSNPFDWMN-IISVSGKTNFF 311

Query: 121 ETRVTEYQQG 130
           E +V EY + 
Sbjct: 312 EKKVGEYAKA 321


>gi|91215505|ref|ZP_01252476.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
 gi|91186457|gb|EAS72829.1| probable ribonucleoside-diphosphate reductase small chain
           [Psychroflexus torquis ATCC 700755]
          Length = 326

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 74/131 (56%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  +  +++ R ++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGVHCDFAV------HLHNEHLVNQVPKERIRAIIVDALTIEREFV 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+A+R   ++G +  +  T NPF +M ++I L+ + NFF
Sbjct: 240 TESLPVSLIGMNSNLMTQYLEFVADRLLFELGCDKEYG-TANPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 298 EKRVGEYQKAG 308


>gi|326917964|ref|XP_003205263.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Meleagris gallopavo]
          Length = 353

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  +  +++ R ++  A  +E  + 
Sbjct: 216 MPGLTFSNELISRDEGLHCDFACLMFH-------YLVNRPSEERVREIIVNAVEIEQEFL 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F + ENPF +M E I L+ + NFF
Sbjct: 269 TEALPVGLIGMNCTLMKQYIEFVADRLLMELGFSKVF-HAENPFDFM-ENISLEGKTNFF 326

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 327 EKRVSEYQRFA 337


>gi|118087248|ref|XP_418364.2| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 353

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  +  +++ R ++  A  +E  + 
Sbjct: 216 MPGLTFSNELISRDEGLHCDFACLMFH-------YLVNRPSEERVREIIVNAVEIEQEFL 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F + ENPF +M E I L+ + NFF
Sbjct: 269 TEALPVGLIGMNCTLMKQYIEFVADRLLMELGFSKVF-HAENPFDFM-ENISLEGKTNFF 326

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 327 EKRVSEYQRFA 337


>gi|281200507|gb|EFA74725.1| ribonucleotide reductase small subunit [Polysphondylium pallidum
           PN500]
          Length = 335

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 75/136 (55%), Gaps = 13/136 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQI--KIENPHLWTKEFQQKSRTMLHEATLLEIA 58
           M G+    + I RDE LH +F   +  ++  K++N  +          T++ +A   E  
Sbjct: 189 MHGLTFSNELISRDEGLHCDFACLLYQKLQNKLDNNTI---------ETIIRDAVACEKE 239

Query: 59  YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
           +  E++P   +G+N+ S  QY++F A+R    +G + ++  + NPF WM E+I L+++ N
Sbjct: 240 FITESLPVDLIGMNSRSMSQYIEFCADRLLLSLGYKKIYN-SSNPFDWM-EMISLQRKTN 297

Query: 119 FFETRVTEYQQGAGLK 134
           FFE +V+EYQ+    K
Sbjct: 298 FFEGKVSEYQKSGVAK 313


>gi|237752265|ref|ZP_04582745.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           winghamensis ATCC BAA-430]
 gi|229376507|gb|EEO26598.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           winghamensis ATCC BAA-430]
          Length = 343

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E PHL+TK+  ++   M  EA  +E  + 
Sbjct: 207 MLGSAQMIRFIQRDEVTHLLLFQNMINSLRKEMPHLFTKDLIEEVLEMFREAVRVESTWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +    +Y++++A+ R  ++GL  L+    +P  W+       ++K NF
Sbjct: 267 EYITQGQILGLTSEIIHEYIRYLADNRLTRVGLPALYN-ARHPIKWVDSFSSFNEQKTNF 325

Query: 120 FETRVTEYQQGA 131
           FE  VT Y +G+
Sbjct: 326 FEGNVTNYAKGS 337


>gi|188588149|ref|YP_001919720.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium
           botulinum E3 str. Alaska E43]
 gi|251778737|ref|ZP_04821657.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
 gi|188498430|gb|ACD51566.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum E3 str. Alaska E43]
 gi|243083052|gb|EES48942.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum E1 str. 'BoNT E Beluga']
          Length = 344

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 74/135 (54%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ ENP  +T + + + + M+      EI + 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIIKELQSENPESFTTDLKNELKEMMRIGVENEILWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           H  +     G+N    E Y++++ N+R  +IGL  LF+ + ENP  W+  V +    K +
Sbjct: 266 HYVIGDKIQGINKKLIEDYIKYLGNKRLKEIGLGMLFEGFEENPATWVDVVANSNSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y + + L
Sbjct: 326 FFEAKSTAYAKVSTL 340


>gi|168186576|ref|ZP_02621211.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum C str. Eklund]
 gi|169295422|gb|EDS77555.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           botulinum C str. Eklund]
          Length = 342

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K EN  ++T+   ++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEITHLILFQNIIKELKNENLDIFTESIIEEFRMMMKTGVEHEIKWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    E+Y+++++N R + IGLE L+ + TE+P  W+     L   K +
Sbjct: 262 QYVTNNEILGINNNLIEKYIKYLSNLRLNAIGLEVLYPEITEHPMEWIENFSKLNNTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAAFDFD 339


>gi|7106399|ref|NP_033130.1| ribonucleoside-diphosphate reductase subunit M2 [Mus musculus]
 gi|132626|sp|P11157|RIR2_MOUSE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|22218698|pdb|1H0N|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|22218699|pdb|1H0O|A Chain A, Cobalt Substitution Of Mouse R2 Ribonucleotide Reductase
           To Model The Reactive Diferrous State
 gi|52696260|pdb|1W68|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Oxidizing Conditions. A Fully Occupied
           Dinuclear Iron Cluster.
 gi|52696261|pdb|1W69|A Chain A, Crystal Structure Of Mouse Ribonucleotide Reductase
           Subunit R2 Under Reducing Conditions. A Fully Occupied
           Dinuclear Iron Cluster And Bound Acetate.
 gi|157834262|pdb|1XSM|A Chain A, Protein R2 Of Ribonucleotide Reductase From Mouse
 gi|50720|emb|CAA33707.1| M2 ribonucleotide reductase [Mus musculus]
 gi|200768|gb|AAA40062.1| ribonucleotide reductase subunit M2 [Mus musculus]
 gi|26354034|dbj|BAC40647.1| unnamed protein product [Mus musculus]
 gi|54887418|gb|AAH85136.1| Ribonucleotide reductase M2 [Mus musculus]
 gi|74139292|dbj|BAE40793.1| unnamed protein product [Mus musculus]
 gi|74151119|dbj|BAE27683.1| unnamed protein product [Mus musculus]
 gi|74179887|dbj|BAE36508.1| unnamed protein product [Mus musculus]
 gi|74188932|dbj|BAE39238.1| unnamed protein product [Mus musculus]
 gi|74189151|dbj|BAE39331.1| unnamed protein product [Mus musculus]
 gi|74206394|dbj|BAE24918.1| unnamed protein product [Mus musculus]
 gi|74211991|dbj|BAE40165.1| unnamed protein product [Mus musculus]
          Length = 390

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ R ++  A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPAEQRVREIITNAVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR-VENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|118089007|ref|XP_419948.2| PREDICTED: similar to small subunit ribonucleotide reductase
           isoform 2 [Gallus gallus]
          Length = 384

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ + ++  A L+E  + 
Sbjct: 247 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIRKPSEERVKEIIMNAVLIEQEFL 299

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 300 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFRKIYK-VENPFDFM-ENISLEGKTNFF 357

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 358 EKRVGEYQR 366


>gi|74207686|dbj|BAE40088.1| unnamed protein product [Mus musculus]
          Length = 390

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ R ++  A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPAEQRVREIITNAVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR-VENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|148705043|gb|EDL36990.1| ribonucleotide reductase M2 [Mus musculus]
          Length = 411

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ R ++  A  +E  + 
Sbjct: 274 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPAEQRVREIITNAVRIEQEFL 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 327 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFR-VENPFDFM-ENISLEGKTNFF 384

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 385 EKRVGEYQR 393


>gi|241668401|ref|ZP_04755979.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876934|ref|ZP_05249644.1| glutaredoxin 3/ribonucleotide reductase beta subunit [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254842955|gb|EET21369.1| glutaredoxin 3/ribonucleotide reductase beta subunit [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
          Length = 410

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   +F+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAVELEDKFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   ++Y++ I +RR +Q+GL  ++   +NP  W+  +++     NF
Sbjct: 328 DLAYEIGTIEGLKADEVKEYIRHITDRRLNQLGLNEIYNIDKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGNWD 405


>gi|167627842|ref|YP_001678342.1| bifunctional gluaredoxin/ribonucleoside-diphosphate reductase
           subunit beta [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597843|gb|ABZ87841.1| Ribonucleoside-diphosphate reductase [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 410

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDES+H+     +      ENP++   +F+++   M  +A  LE  + 
Sbjct: 268 MKGMGKVVEWSIRDESMHVEGNAALFRIYCQENPYIVDNQFKKEIYLMASKAVELEDKFI 327

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + GL A   ++Y++ I +RR +Q+GL  ++   +NP  W+  +++     NF
Sbjct: 328 DLAYEIGTIEGLKADEVKEYIRHITDRRLNQLGLNEIYNIDKNPLTWLEWILNGADHTNF 387

Query: 120 FETRVTEYQQGAGL--KWD 136
           FE RVTEY+  AGL   WD
Sbjct: 388 FENRVTEYEV-AGLTGNWD 405


>gi|118089009|ref|XP_001231545.1| PREDICTED: similar to small subunit ribonucleotide reductase
           isoform 1 [Gallus gallus]
          Length = 392

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ + ++  A L+E  + 
Sbjct: 255 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIRKPSEERVKEIIMNAVLIEQEFL 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 308 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFRKIYK-VENPFDFM-ENISLEGKTNFF 365

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 366 EKRVGEYQR 374


>gi|194036959|ref|XP_001925036.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B [Sus
           scrofa]
          Length = 351

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  + + R ++  A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEARVREIIVNAVEIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCVLMKQYIEFVADRLLTELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|326916502|ref|XP_003204546.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Meleagris gallopavo]
          Length = 339

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ + ++  A L+E  + 
Sbjct: 202 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIRKPSEERVKEIIMNAVLIEQEFL 254

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 255 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFRKIYK-VENPFDFM-ENISLEGKTNFF 312

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 313 EKRVGEYQR 321


>gi|302409182|ref|XP_003002425.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
 gi|261358458|gb|EEY20886.1| ribonucleoside-diphosphate reductase small chain [Verticillium
           albo-atrum VaMs.102]
          Length = 414

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  +E  + 
Sbjct: 264 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQTVQDIVTDAVNIEQEFL 316

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+NA   +QY++F+A+R    +G E ++K T NPF +M E I L  + NFF
Sbjct: 317 TEALPCGLLGMNATLMKQYIEFVADRLLVALGNEKVYKAT-NPFDFM-ENISLGGKTNFF 374

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 375 EKRVADYQKAG 385


>gi|223039245|ref|ZP_03609535.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           rectus RM3267]
 gi|222879606|gb|EEF14697.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           rectus RM3267]
          Length = 340

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T E + K   M   A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRTERPDLFTSEMEAKIYDMFKRAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      EQY++++ ++R   IGL+  +    +P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEQYIRYLIDQRLVAIGLKRRYD-ARHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 323 FEAKVTNYSKGS 334


>gi|225850104|ref|YP_002730338.1| ribonucleoside-diphosphate reductase, beta subunit [Persephonella
           marina EX-H1]
 gi|225645787|gb|ACO03973.1| ribonucleoside-diphosphate reductase, beta subunit [Persephonella
           marina EX-H1]
          Length = 329

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 70/129 (54%), Gaps = 3/129 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKE-FQQKSRTMLHEATLLEIAY 59
           M  +    + I+ DESLHL  GI+ I  I  ENP +   E F +  +  + +A  LE+ Y
Sbjct: 199 MKNVVSGVELILIDESLHLQNGIEAILTIVEENPEIVDDEKFVENIKETIIDAVELELNY 258

Query: 60  AHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
                    + G++    E+YM++IA+RR  ++G +P FK  +NP  ++ +  D+KK  N
Sbjct: 259 LKTKFGGTTIFGVSYKELEKYMKYIADRRLEELGFDPQFKIDQNPLKFLQKE-DVKKLTN 317

Query: 119 FFETRVTEY 127
           FFE   TEY
Sbjct: 318 FFEVSSTEY 326


>gi|281340156|gb|EFB15740.1| hypothetical protein PANDA_011632 [Ailuropoda melanoleuca]
          Length = 336

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 199 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 251

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 252 TEALPVGLIGMNCVLMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 309

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ A
Sbjct: 310 EKRVAEYQRFA 320


>gi|45360749|ref|NP_989048.1| ribonucleotide reductase M2, gene 1 [Xenopus (Silurana) tropicalis]
 gi|38174078|gb|AAH61353.1| ribonucleotide reductase M2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 378

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H+  K  +Q+ R ++ +A  +E  + 
Sbjct: 241 MPGLTFSNELISRDEGLHTDFACLLFK-------HVVHKPSEQRVREIIIDAVKIEQEFL 293

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G + +FK +ENPF +M E I L+ + NFF
Sbjct: 294 TEALPVELIGMNCKLMKQYIEFVADRLLLELGFKKIFK-SENPFDFM-ENISLEGKTNFF 351

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 352 EKKVAEYQK 360


>gi|325261084|ref|ZP_08127822.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium sp.
           D5]
 gi|324032538|gb|EGB93815.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium sp.
           D5]
          Length = 347

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     ++ ++K E P L+T E  +K R+M+ E    EI + 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFRSILMELKKEEPWLFTAEKTEKYRSMIREGCEQEIRWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC  + LEP+++  E       W+S+  +    K
Sbjct: 267 HYVIGDDIQGLNREMITDYIQYLGNLRCRGLELEPVYEGHEKEPESMSWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|310831442|ref|YP_003970085.1| putative ribonucleoside-diphosphate reductase small subunit
           [Cafeteria roenbergensis virus BV-PW1]
 gi|309386626|gb|ADO67486.1| putative ribonucleoside-diphosphate reductase small subunit
           [Cafeteria roenbergensis virus BV-PW1]
          Length = 326

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H ++ I + + ++        K  Q+K + M  +A   E  + 
Sbjct: 189 MPGLISSNELIARDEGMHCDYSIMLYHMLQ-------NKLSQEKIQQMFKDAVETERIFI 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA   EQY++F+A++   ++G   +FK  +NPF WM E I ++ + NFF
Sbjct: 242 CESLPCSLLGMNADLMEQYIKFVADQLIIKLGYNKIFK-VDNPFTWM-EAISIEGKTNFF 299

Query: 121 ETRVTEYQQG 130
           E R T+YQ+ 
Sbjct: 300 EHRPTQYQRA 309


>gi|9634266|ref|NP_037805.1| ORF45 ribonucleotide reductase small subunit (rr2) [Spodoptera
           exigua MNPV]
 gi|6960505|gb|AAF33575.1|AF169823_45 ORF45 ribonucleotide reductase small subunit (rr2) [Spodoptera
           exigua MNPV]
          Length = 313

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (52%), Gaps = 15/136 (11%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVIN---QIKIENPHLWTKEFQQKSRTMLHEATLLEI 57
           M G+    + I RDE LH NF     N     K++ P +           M  EA  +E+
Sbjct: 179 MPGLTFSNELISRDEGLHTNFACLYYNTRVDQKLDAPTV---------NDMFSEAVAIEM 229

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P+  VG+NA    +Y++F+A+R   Q+   P   YTENPF +M+  I L+ + 
Sbjct: 230 EFFAEALPESLVGMNANMMRKYIEFVADRLLVQLKY-PKMYYTENPFEFMNN-ISLEGKT 287

Query: 118 NFFETRVTEYQQ-GAG 132
           NFFE RV EY++ GAG
Sbjct: 288 NFFEKRVGEYKRFGAG 303


>gi|301774462|ref|XP_002922647.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 B-like
           [Ailuropoda melanoleuca]
          Length = 387

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 250 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 303 TEALPVGLIGMNCVLMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ A
Sbjct: 361 EKRVAEYQRFA 371


>gi|73974198|ref|XP_539109.2| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 2 [Canis familiaris]
          Length = 351

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCVLMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ A
Sbjct: 325 EKRVAEYQRFA 335


>gi|291276761|ref|YP_003516533.1| ribonucleoside-diphosphate reductase subunit beta [Helicobacter
           mustelae 12198]
 gi|290963955|emb|CBG39794.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           mustelae 12198]
          Length = 344

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  ++I RDE  HL    ++I  +K E P L+ K+ +++   M   A  +E A+ 
Sbjct: 209 MLGSSQMIRFIQRDEVTHLILFQNMIRTLKKERPDLFDKDLEEEIVEMFRRAVEIEAAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL      QY+Q++A++R  ++G+  L+   E+P  W+ +     +++ NF
Sbjct: 269 EYITQGQILGLTGEVIHQYIQYLADQRLSKVGMPKLYN-VEHPIKWVEQYASFNEQRTNF 327

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 328 FEAKVTNYAKGS 339


>gi|293343290|ref|XP_002725449.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like [Rattus
           norvegicus]
 gi|293355176|ref|XP_002728627.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Rattus
           norvegicus]
          Length = 390

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVKEIITNAVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFK-VENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|301772278|ref|XP_002921557.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Ailuropoda melanoleuca]
          Length = 393

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ R ++  A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVREIIINAVRIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 309 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 367 EKRVGEYQR 375


>gi|331086748|ref|ZP_08335825.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 9_1_43BFAA]
 gi|330409914|gb|EGG89349.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 9_1_43BFAA]
          Length = 347

 Score = 74.3 bits (181), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ +++ E P L+++E +++ R M+ E    EIA+ 
Sbjct: 207 MTGSVQEIRYINRDENTHLWLFTNILRELRKELPELFSEEKEKEYRQMIREGCEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GL+      Y++++ N RC  +GL P+++  E       W+S+  +    K
Sbjct: 267 HYVIGDAVSGLSCDMITDYVKYLGNLRCKNLGLAPIYEGHEKEPESMGWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + L
Sbjct: 327 TDFFEAKSTAYAKSSAL 343


>gi|149637725|ref|XP_001508783.1| PREDICTED: similar to Ribonucleotide reductase M2 B (TP53
           inducible) [Ornithorhynchus anatinus]
          Length = 401

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 76/131 (58%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   ++ Q  ++ P       + K + ++ +A  +E  + 
Sbjct: 264 MPGLTFSNELISRDEGLHCDFAC-LMFQYLVKKPS------EDKVKEIIIDAVEIEQEFL 316

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F +++NPF +M E I L+ + NFF
Sbjct: 317 TEALPVGLIGMNCTLMKQYIEFVADRLLVELGFSKVF-HSDNPFDFM-ENISLEGKTNFF 374

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 375 EKRVSEYQRFA 385


>gi|330998673|ref|ZP_08322403.1| ribonucleoside-diphosphate reductase, beta subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|329576534|gb|EGG58042.1| ribonucleoside-diphosphate reductase, beta subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 327

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 72/136 (52%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + + DE+LH    I +  +  IENP LWT   +++    +  M+  E   +
Sbjct: 180 MKGMGQIIAWSINDETLHTESMIRLFREYIIENPELWTDSLKKRIYDIAEKMIELEDAFI 239

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M K    L+    + Y+++I +RR   +G++ +FK   NP PW+  ++ +  
Sbjct: 240 DLAFGVNDMSKQ--NLSPADVKAYIRWICDRRLAAMGMKEIFKVNVNPLPWVDSMLGV-T 296

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RV +Y +GA
Sbjct: 297 HTNFFENRVVDYAKGA 312


>gi|303258316|ref|ZP_07344319.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderiales
           bacterium 1_1_47]
 gi|302858762|gb|EFL81850.1| ribonucleoside-diphosphate reductase, beta subunit [Burkholderiales
           bacterium 1_1_47]
          Length = 328

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 72/136 (52%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQK----SRTMLH-EATLL 55
           M G+ +   + + DE+LH    I +  +  IENP LWT   +++    +  M+  E   +
Sbjct: 181 MKGMGQIIAWSINDETLHTESMIRLFREYIIENPELWTDSLKKRIYDIAEKMIELEDAFI 240

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M K    L+    + Y+++I +RR   +G++ +FK   NP PW+  ++ +  
Sbjct: 241 DLAFGVNDMSKQ--NLSPADVKAYIRWICDRRLAAMGMKEIFKVNVNPLPWVDSMLGV-T 297

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RV +Y +GA
Sbjct: 298 HTNFFENRVVDYAKGA 313


>gi|325663145|ref|ZP_08151595.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 4_1_37FAA]
 gi|325470599|gb|EGC73829.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 4_1_37FAA]
          Length = 347

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ +++ E P L+++E +++ R M+ E    EIA+ 
Sbjct: 207 MTGSVQEIRYINRDENTHLWLFTNILRELRKELPELFSEEKEKEYRQMIREGCEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GL+      Y++++ N RC  +GL P+++  E       W+S+  +    K
Sbjct: 267 HYVIGDAVSGLSCDMITDYVKYLGNLRCKNLGLAPIYEGHEKEPESMGWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + L
Sbjct: 327 TDFFEAKSTAYAKSSAL 343


>gi|224048725|ref|XP_002196356.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Taeniopygia
           guttata]
          Length = 390

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ + ++  A L+E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIHKPSEERVKEIIMNAVLIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIYK-AENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|148232385|ref|NP_001085389.1| ribonucleotide reductase M2, gene 1 [Xenopus laevis]
 gi|48735122|gb|AAH72071.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H+  K  +Q+ R ++ +A  +E  + 
Sbjct: 269 MPGLTFSNELISRDEGLHTDFACLLFK-------HVVHKPSEQRVREIIIDAVKIEQEFL 321

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G + +FK +ENPF +M E I L+ + NFF
Sbjct: 322 TEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK-SENPFDFM-ENISLEGKTNFF 379

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 380 EKKVGEYQK 388


>gi|315635423|ref|ZP_07890689.1| ribonucleotide-diphosphate reductase beta subunit [Arcobacter
           butzleri JV22]
 gi|315480181|gb|EFU70848.1| ribonucleotide-diphosphate reductase beta subunit [Arcobacter
           butzleri JV22]
          Length = 339

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  ++I RDE  HL    ++IN ++ E P L+T+E ++  R M  +A  LE ++ 
Sbjct: 203 MLGSSQMIRFIQRDEVTHLLLFQNMINSVRKERPDLFTQELEETVRAMFRKAVDLEASWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G       QY++++A+RR   +G +  +   ++P PW+        ++ NF
Sbjct: 263 AYITQGQILGFTDGIIRQYIEYLADRRLEAVGYKAEYG-VKHPIPWVDGYASFNDQRTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  V  Y +G+
Sbjct: 322 FEGNVVNYSKGS 333


>gi|327261311|ref|XP_003215474.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 2 [Anolis carolinensis]
          Length = 390

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIITNAVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK-AENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|194474072|ref|NP_001124015.1| ribonucleoside-diphosphate reductase subunit M2 B [Rattus
           norvegicus]
 gi|149066498|gb|EDM16371.1| ribonucleotide reductase M2 B (TP53 inducible) (predicted) [Rattus
           norvegicus]
          Length = 351

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++   ++ +A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVMEIIVDAVKIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|6525234|gb|AAF15363.1|AF205376_1 ribonucleotide reductase R2 subunit [Plasmodium falciparum]
          Length = 320

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + +  + P       +Q  + ++ EA  +E ++  E
Sbjct: 185 GLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------EQMVQNIVKEAVEVERSFICE 237

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 238 SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWM-DLISLQGKTNFFEK 295

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 296 RVADYQKSG 304


>gi|327261309|ref|XP_003215473.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 1 [Anolis carolinensis]
          Length = 394

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIITNAVRIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 310 TEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK-AENPFDFM-ENISLEGKTNFF 367

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 368 EKRVGEYQR 376


>gi|242095388|ref|XP_002438184.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
 gi|241916407|gb|EER89551.1| hypothetical protein SORBIDRAFT_10g009290 [Sorghum bicolor]
          Length = 339

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++       +K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYELLR-------SKLDEARVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++  T NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVALVGMNGGLMSQYIEFVADRLLMALGCKKMYNAT-NPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 308 EKRVGDYQKAS 318


>gi|76630263|ref|XP_880783.1| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 3 [Bos
           taurus]
 gi|297480612|ref|XP_002691528.1| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 2 [Bos
           taurus]
 gi|296482362|gb|DAA24477.1| ribonucleotide reductase M2 polypeptide isoform 2 [Bos taurus]
          Length = 341

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 204 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSEQRVKEIIVNAVRIEQEFL 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 257 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 314

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 315 EKRVGEYQR 323


>gi|2500209|sp|Q60561|RIR2_MESAU RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|49650|emb|CAA48232.1| ribonucleotide reductase [Mesocricetus auratus]
          Length = 386

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVQEIITNAVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFK-VENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|260909050|gb|ACX54162.1| RR2 protein [Shrimp white spot syndrome virus]
 gi|260909052|gb|ACX54163.1| RR2 protein [Shrimp white spot syndrome virus]
 gi|260909054|gb|ACX54164.1| RR2 protein [Shrimp white spot syndrome virus]
 gi|260909056|gb|ACX54165.1| RR2 protein [Shrimp white spot syndrome virus]
          Length = 349

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 8/128 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    ++I RDE LH +F   ++ +  ++ P       +++   ++ EA  +E  +   
Sbjct: 225 GLTSSNEFISRDEGLHRDFACMLLKKGFVDTPS------RERILEIVTEAVRIEQEFLTV 278

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   VG+N     QY++F+A++   ++GLE  +  T NPFP+M   I L+ + NFFE 
Sbjct: 279 SLPVKLVGMNCKLMSQYIEFVADKLLVEMGLEKHYNVT-NPFPFMDN-ISLENKTNFFEK 336

Query: 123 RVTEYQQG 130
           RV EYQ+ 
Sbjct: 337 RVAEYQRA 344


>gi|296421312|ref|XP_002840209.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636423|emb|CAZ84400.1| unnamed protein product [Tuber melanosporum]
          Length = 397

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   + N       HL  +  QQ  + ++ EA  +E  + 
Sbjct: 250 MPGLSFSNELISRDEGLHTDFACLLFN-------HLNNRPSQQAVQDIIVEAVGIEQEFL 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G  P F    NPF +M E I L  + NFF
Sbjct: 303 TEALPCALLGMNSKLMKQYIEFVADRLLLSLG-NPKFYNATNPFDFM-ESISLAGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 361 EKRVGDYQKAG 371


>gi|327261313|ref|XP_003215475.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           isoform 3 [Anolis carolinensis]
          Length = 391

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 254 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIITNAVRIEQEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 307 TEALPVNLIGMNCTLMKQYIEFVADRLILELGFNKIYK-AENPFDFM-ENISLEGKTNFF 364

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 365 EKRVGEYQR 373


>gi|124808087|ref|XP_001348226.1| ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
 gi|23497116|gb|AAN36665.1|AE014816_50 ribonucleotide reductase small subunit [Plasmodium falciparum 3D7]
          Length = 349

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + +  + P       +Q  + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------EQMVQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|88682973|gb|AAI05512.1| RRM2 protein [Bos taurus]
          Length = 338

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 201 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSEQRVKEIIVNAVRIEQEFL 253

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 254 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 311

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 312 EKRVGEYQR 320


>gi|157736292|ref|YP_001488975.1| ribonucleotide-diphosphate reductase subunit beta [Arcobacter
           butzleri RM4018]
 gi|157698146|gb|ABV66306.1| ribonucleoside-diphosphate reductase, beta chain [Arcobacter
           butzleri RM4018]
          Length = 339

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  ++I RDE  HL    ++IN ++ E P L+T E ++  R M  +A  LE ++ 
Sbjct: 203 MLGSSQMIRFIQRDEVTHLLLFQNMINSVRKERPDLFTSELEETVRAMFRKAVDLEASWG 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G       QY++++A+RR   +G +  +   ++P PW+        ++ NF
Sbjct: 263 AYITQGQILGFTDGIIRQYIEYLADRRLEAVGYKAEYG-VKHPIPWVDGYASFNDQRTNF 321

Query: 120 FETRVTEYQQGA 131
           FE  V  Y +G+
Sbjct: 322 FEGNVVNYSKGS 333


>gi|210616053|ref|ZP_03290925.1| hypothetical protein CLONEX_03144 [Clostridium nexile DSM 1787]
 gi|210149961|gb|EEA80970.1| hypothetical protein CLONEX_03144 [Clostridium nexile DSM 1787]
          Length = 355

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+T+++  + R+M+ E    EI + 
Sbjct: 215 MPGSVQEIRYINRDENTHLWLFRNILIELKKEQPDLFTEQYIDEYRSMIKEGCEQEIKWG 274

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC  +G  P+++  E       W+S+  +    K
Sbjct: 275 HYVIGDDVQGLNREMITDYVQYLGNLRCTNLGFAPIYEGHETEPESMRWVSQYSNANAIK 334

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 335 TDFFEARSTAYAKSSAL 351


>gi|294950175|ref|XP_002786498.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239900790|gb|EER18294.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 350

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + N +K      +T+   ++   ++  A  +E  + 
Sbjct: 196 MPGLTFSNELISRDEGLHADFACLLYNMLK------YTRLPDERVHEIVRGAVEVERVFI 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    +Y++F+A+R    +G   L+  T NPF WM ++I L+ + NFF
Sbjct: 250 SESLPVSLIGMNSQLMCRYIEFVADRLLVALGHPKLYNAT-NPFDWM-KMISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+G 
Sbjct: 308 EKRVGEYQKGG 318


>gi|313675915|ref|YP_004053911.1| ribonucleoside-diphosphate reductase [Marivirga tractuosa DSM 4126]
 gi|312942613|gb|ADR21803.1| Ribonucleoside-diphosphate reductase [Marivirga tractuosa DSM 4126]
          Length = 331

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 74/134 (55%), Gaps = 8/134 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N HL  K  ++K   ++ +A  +E  + 
Sbjct: 190 MPGLTFSNELISRDEGLHCDFAC------LLYNDHLVNKLSKEKVTAIITDAVEIEKEFV 243

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+NA    QY++F+A+R   ++  + ++  + NPF +M E+I L+ + NFF
Sbjct: 244 TDSLPVKLIGMNADLMCQYIEFVADRLLQELRCDKVYG-SSNPFDFM-EMISLQGKTNFF 301

Query: 121 ETRVTEYQQGAGLK 134
           E RV +YQ+   +K
Sbjct: 302 EKRVGDYQKAGVMK 315


>gi|297805560|ref|XP_002870664.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297316500|gb|EFH46923.1| ribonucleoside-diphosphate reductase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 333

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++       TK  +++ ++++ +A  +E  + 
Sbjct: 189 MPGLTFSNELISRDEGLHCDFACLIYSLLR-------TKLDEERLKSIVCDAVEIEREFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++  + NPF WM E+I L+ + NFF
Sbjct: 242 CDALPCALVGMNRELMSQYIEFVADRLLTALGCGKVYGVS-NPFDWM-ELISLQGKTNFF 299

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 300 EKRVGEYQKAS 310


>gi|20809684|gb|AAH28932.1| Similar to ribonucleotide reductase protein r2 class I [Homo
           sapiens]
          Length = 172

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 35  MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 87

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 88  TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 145

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 146 EKRVGEYQR 154


>gi|7672989|gb|AAF66689.1|AF144620_1 ribonucleotide reductase small subunit [shrimp white spot syndrome
           virus]
          Length = 413

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 8/128 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    ++I RDE LH +F   ++ +  ++ P       +++   ++ EA  +E  +   
Sbjct: 240 GLTSSNEFISRDEGLHRDFACMLLKKGFVDTPS------RERILEIVTEAVRIEQEFLTV 293

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   VG+N     QY++F+A++   ++GLE  +  T NPFP+M   I L+ + NFFE 
Sbjct: 294 SLPVKLVGMNCKLMSQYIEFVADKLLVEMGLEKHYNVT-NPFPFMDN-ISLENKTNFFEK 351

Query: 123 RVTEYQQG 130
           RV EYQ+ 
Sbjct: 352 RVAEYQRA 359


>gi|77748199|gb|AAI06683.1| MGC78958 protein [Xenopus laevis]
          Length = 406

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H+  K  +Q+ R ++ +A  +E  + 
Sbjct: 269 MPGLTFSNELISRDEGLHTDFACLLFK-------HVVHKPSEQRVREIIIDAVKIEQEFL 321

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G + +FK +ENPF +M E I L+ + NFF
Sbjct: 322 IEALPVELIGMNCTLMKQYIEFVADRLLLELGFKKIFK-SENPFDFM-ENISLEGKTNFF 379

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 380 EKKVGEYQK 388


>gi|17158292|ref|NP_477710.1| wsv188 [Shrimp white spot syndrome virus]
 gi|14189948|gb|AAK55515.1|AF267731_1 ribonucleotide reductase small subunit [shrimp white spot syndrome
           virus]
 gi|15021490|gb|AAK77767.1|AF369029_98 ORF98, putative ribonucleotide reductase small subunit (RR2)
           [shrimp white spot syndrome virus]
 gi|17016586|gb|AAL33192.1| wsv188 [shrimp white spot syndrome virus]
 gi|19481835|gb|AAL89111.1| WSSV243 [shrimp white spot syndrome virus]
          Length = 413

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 8/128 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    ++I RDE LH +F   ++ +  ++ P       +++   ++ EA  +E  +   
Sbjct: 240 GLTSSNEFISRDEGLHRDFACMLLKKGFVDTPS------RERILEIVTEAVRIEQEFLTV 293

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   VG+N     QY++F+A++   ++GLE  +  T NPFP+M   I L+ + NFFE 
Sbjct: 294 SLPVKLVGMNCKLMSQYIEFVADKLLVEMGLEKHYNVT-NPFPFMDN-ISLENKTNFFEK 351

Query: 123 RVTEYQQG 130
           RV EYQ+ 
Sbjct: 352 RVAEYQRA 359


>gi|227501022|ref|ZP_03931071.1| ribonucleoside-diphosphate reductase [Anaerococcus tetradius ATCC
           35098]
 gi|227216795|gb|EEI82193.1| ribonucleoside-diphosphate reductase [Anaerococcus tetradius ATCC
           35098]
          Length = 352

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN +K E   L+  E Q   R ML E    EIA+ 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSLINDLKKEREDLFVPELQNYYRNMLKEGVEQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN    E Y++++ N R   +GLE L++ + E P    W+ E  D    K
Sbjct: 272 KYAIGNEIAGLNEKMIEDYIKYLGNLRAKGLGLEALYEGFDEIPESMKWVDEYSDPNGVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +VT Y + + ++ D
Sbjct: 332 TDFFEAKVTAYSKSSIIEDD 351


>gi|58260834|ref|XP_567827.1| ribonucleotide reductase small subunit [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|134117207|ref|XP_772830.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255448|gb|EAL18183.1| hypothetical protein CNBK2010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229908|gb|AAW46310.1| ribonucleotide reductase small subunit, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 430

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 70/130 (53%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + N +K       T E       ++ EA ++E  + 
Sbjct: 282 MPGLTFSNELISRDEGMHTDFACLLYNHLK---HRCSTDEVHH----IVSEALVIEKQFL 334

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF WM E+I L+ + NFF
Sbjct: 335 TDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPFDWM-ELISLQGKANFF 392

Query: 121 ETRVTEYQQG 130
           E+RV+ YQ+ 
Sbjct: 393 ESRVSAYQKA 402


>gi|76630259|ref|XP_584910.2| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|297480610|ref|XP_002691527.1| PREDICTED: ribonucleotide reductase M2 polypeptide isoform 1 [Bos
           taurus]
 gi|296482361|gb|DAA24476.1| ribonucleotide reductase M2 polypeptide isoform 1 [Bos taurus]
          Length = 389

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 252 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSEQRVKEIIVNAVRIEQEFL 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 305 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 362

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 363 EKRVGEYQR 371


>gi|225010999|ref|ZP_03701465.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
 gi|225004906|gb|EEG42862.1| Ribonucleoside-diphosphate reductase [Flavobacteria bacterium
           MS024-3C]
          Length = 328

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 74/136 (54%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H ++ +       + N HL  K  + + R +L +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDYAV------HLHNHHLINKVPKARIREILVDALNIERTFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++  E  +  + NPF +M ++I L+ + NFF
Sbjct: 241 TESLPASLIGMNAKLMTQYLEFVTDRLLVELQCEKEYNVS-NPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   L  D
Sbjct: 299 EKRVSEYQKAGVLNKD 314


>gi|156847978|ref|XP_001646872.1| hypothetical protein Kpol_2002p85 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117553|gb|EDO19014.1| hypothetical protein Kpol_2002p85 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 400

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 72/132 (54%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   + + IK + +P +  K        ++ EA  +E  Y
Sbjct: 258 MPGLTFSNELICRDEGLHTDFACLLFSHIKNKPDPAIVEK--------IVTEAVEIEKRY 309

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+NA    QY++F+A+R     G E +FK  ENPF +M E I L  + NF
Sbjct: 310 FTDALPVALLGMNADLMNQYVEFVADRLLVAFGNEKVFK-VENPFDFM-ENISLAGKTNF 367

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+ +
Sbjct: 368 FEKRVSDYQKAS 379


>gi|326386063|ref|ZP_08207687.1| ribonucleotide-diphosphate reductase subunit beta [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209288|gb|EGD60081.1| ribonucleotide-diphosphate reductase subunit beta [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 351

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  + Q  ++     TK  ++       +   LE A+ 
Sbjct: 178 MKGMGQIVSWSVRDETLHCE-GITRLFQAFVQERDCMTKAVREDIIDCCQKTVRLEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                +G V G++A   ++Y+++IA+ R  Q+G +P++   E+P PW++ +++  +  NF
Sbjct: 237 DLAFEQGPVPGMSAKEIKRYIRYIADWRLGQLGFQPIYMIEEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|198420293|ref|XP_002130242.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase subunit
           M2 (Ribonucleotide reductase small subunit)
           (Ribonucleotide reductase small chain) [Ciona
           intestinalis]
          Length = 393

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  + +   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSEARVVEIVKDAVTIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E+I L+ + NFF
Sbjct: 309 TDALPVALIGMNNKLMKQYIEFVADRLLVELGCSKVFK-VENPFDFM-ELISLEGKTNFF 366

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 367 EKRVGEYQKAG 377


>gi|126322530|ref|XP_001380256.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 361

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 76/131 (58%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  K  +++ + ++  A  +E  + 
Sbjct: 224 MPGLTFSNELISRDEGLHCDFACLMFH-------YLVNKPSEERVKEIIINAVEIEQEFL 276

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P G +G+N+   +QY++F+A+R   ++G   +F+ ++NPF +M E I L+ + NFF
Sbjct: 277 TDALPVGLIGINSTLMKQYIEFVADRLLVELGFSKVFQ-SDNPFDFM-ENISLEGKTNFF 334

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 335 EKRVSEYQRFA 345


>gi|187778605|ref|ZP_02995078.1| hypothetical protein CLOSPO_02200 [Clostridium sporogenes ATCC
           15579]
 gi|187772230|gb|EDU36032.1| hypothetical protein CLOSPO_02200 [Clostridium sporogenes ATCC
           15579]
          Length = 342

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   +  ++YI RDE  HL    ++I ++K ENP+++T+E +++ R M+      EI + 
Sbjct: 202 MTATSTIFKYINRDEVTHLVLFQNIIKELKSENPNIFTEELEEEFREMMRMGVEHEIKWG 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +GLN    ++Y+++++N R   IGL+PL+ +  ++P  W+     L   K +
Sbjct: 262 QYVTNNEILGLNDELIDKYIKYLSNLRLTAIGLKPLYPEINKHPMEWIDSFSKLNSTKTD 321

Query: 119 FFETRVTEYQQGAGLKWD 136
           FFE +VT Y + A   +D
Sbjct: 322 FFEAKVTNYTKAAVFDFD 339


>gi|266623614|ref|ZP_06116549.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           hathewayi DSM 13479]
 gi|288864591|gb|EFC96889.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridium
           hathewayi DSM 13479]
          Length = 346

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +     R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNMILELKNEEPELFTPDRVDVYREMIKEGCRQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GL       Y+Q++ N RC  +G EP+++  E       W+S+  +    K
Sbjct: 267 HYAIGDKVPGLTKDMITDYIQYLGNLRCMSLGFEPIYEGHEKEPESMAWVSQYSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|75224904|sp|Q6Y657|RIR2B_ARATH RecName: Full=Putative ribonucleoside-diphosphate reductase small
           chain B; AltName: Full=Ribonucleoside-diphosphate
           reductase R2B subunit; AltName: Full=Ribonucleotide
           reductase small subunit B
 gi|37729626|gb|AAO62422.1| ribonucleotide reductase small subunit [Arabidopsis thaliana]
          Length = 333

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++       TK  + + + ++ +A  +E  + 
Sbjct: 189 MPGLTFSNELISRDEGLHCDFACLIYSLLR-------TKLDEDRLKAIVCDAVEIEREFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++  + NPF WM E+I L+ + NFF
Sbjct: 242 CDALPCALVGMNRELMSQYIEFVADRLLAALGCAKVYGVS-NPFDWM-ELISLQGKTNFF 299

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 300 EKRVGEYQKAS 310


>gi|313115920|ref|ZP_07801347.1| ribonucleoside-diphosphate reductase, beta subunit
           [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310621684|gb|EFQ05212.1| ribonucleoside-diphosphate reductase, beta subunit
           [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 347

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P L+T E  Q  R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNIITELQKEQPELFTAESVQALREMMREGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIG---LEPLFKYTENPFPWMSEVIDLKKEK 117
           H  +     GLN      Y++++ N R   +G   L P F+       W+S+  D    K
Sbjct: 267 HYVIGDDIPGLNRQMISDYIRYLGNLRWTSLGYPALYPGFESEPESMEWVSQYADANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y +   L
Sbjct: 327 TDFFEARSTAYAKSTAL 343


>gi|71043760|ref|NP_001020911.1| ribonucleoside-diphosphate reductase subunit M2 [Rattus norvegicus]
 gi|77416595|sp|Q4KLN6|RIR2_RAT RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|68533806|gb|AAH99082.1| Ribonucleotide reductase M2 [Rattus norvegicus]
 gi|149051013|gb|EDM03186.1| rCG61374 [Rattus norvegicus]
          Length = 390

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  +  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVKEIITNSVRIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E I L+ + NFF
Sbjct: 306 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFK-VENPFDFM-ENISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 364 EKRVGEYQR 372


>gi|295103295|emb|CBL00839.1| Ribonucleotide reductase, beta subunit [Faecalibacterium
           prausnitzii SL3/3]
          Length = 347

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P L+T E  Q  R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNIITELQKEQPELFTAESVQALREMMREGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIG---LEPLFKYTENPFPWMSEVIDLKKEK 117
           H  +     GLN      Y++++ N R   +G   L P F+       W+S+  D    K
Sbjct: 267 HYVIGDDIPGLNRQMISDYIRYLGNLRWTSLGYPALYPGFESEPESMEWVSQYADANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y +   L
Sbjct: 327 TDFFEARSTAYAKSTAL 343


>gi|160942848|ref|ZP_02090088.1| hypothetical protein FAEPRAM212_00325 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445900|gb|EDP22903.1| hypothetical protein FAEPRAM212_00325 [Faecalibacterium prausnitzii
           M21/2]
          Length = 347

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P L+T E  Q  R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNIITELQKEQPELFTAESVQALREMMREGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIG---LEPLFKYTENPFPWMSEVIDLKKEK 117
           H  +     GLN      Y++++ N R   +G   L P F+       W+S+  D    K
Sbjct: 267 HYVIGDDIPGLNRQMISDYIRYLGNLRWTSLGYPALYPGFESEPESMEWVSQYADANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y +   L
Sbjct: 327 TDFFEARSTAYAKSTAL 343


>gi|242076364|ref|XP_002448118.1| hypothetical protein SORBIDRAFT_06g021460 [Sorghum bicolor]
 gi|241939301|gb|EES12446.1| hypothetical protein SORBIDRAFT_06g021460 [Sorghum bicolor]
          Length = 339

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESRVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++    NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVALVGMNGALMSQYIEFVADRLLMALGHKKMYN-VANPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 308 EKRVGEYQKAS 318


>gi|227541|prf||1706181A ribonucleotide reductase
          Length = 290

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 153 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 205

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 206 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 263

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 264 EKRVGEYQR 272


>gi|224055741|ref|XP_002298630.1| predicted protein [Populus trichocarpa]
 gi|222845888|gb|EEE83435.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ EA  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKEAVDIEREFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 241 VDSLPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 299 EKRVGEYQKAS 309


>gi|255536887|ref|XP_002509510.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
 gi|223549409|gb|EEF50897.1| ribonucleoside-diphosphate reductase small chain, putative [Ricinus
           communis]
          Length = 329

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +K        K  +++ + ++ +A  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLIYSLLK-------KKLSEERVKGIVRDAVNIEREFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G    +  + NPF WM E+I L+ + NFF
Sbjct: 241 CDALPCALVGMNGELMSQYIEFVADRLLGALGCGKEYNVS-NPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ A
Sbjct: 299 EKRVGEYQKAA 309


>gi|89890041|ref|ZP_01201552.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
 gi|89518314|gb|EAS20970.1| ribonucleoside-diphosphate reductase small chain [Flavobacteria
           bacterium BBFL7]
          Length = 330

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++   ++ +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDFAV------HLHNHHLVNKVPKERITEIIVDALNIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++  +P++  T NPF +M ++I ++ + NFF
Sbjct: 241 TESLPASLIGMNAKLMTQYLEFVTDRLLGELECDPVYNVT-NPFDFM-DLIGMEGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 299 EKRVGEYQKAG 309


>gi|193784694|dbj|BAG53847.1| unnamed protein product [Homo sapiens]
 gi|193787382|dbj|BAG52588.1| unnamed protein product [Homo sapiens]
          Length = 297

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 160 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 213 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 270

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 271 EKRVGEYQR 279


>gi|125554800|gb|EAZ00406.1| hypothetical protein OsI_22421 [Oryza sativa Indica Group]
          Length = 244

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + R ++ +A  +E  + 
Sbjct: 102 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDEARVREIVADAVDIEREFV 154

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++    NPF WM E+I L+ + NFF
Sbjct: 155 CDALPVALVGMNGDLMSQYIEFVADRLLMALGCKKMYN-VANPFDWM-ELISLQGKTNFF 212

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 213 EKRVGDYQKAS 223


>gi|320536436|ref|ZP_08036471.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           phagedenis F0421]
 gi|320146705|gb|EFW38286.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           phagedenis F0421]
          Length = 363

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I +++ E P L+T E  +  R M+ E    EI + 
Sbjct: 223 MPGSVQEIRYINRDENTHLWLFRSIIQELQKEEPQLFTPENIEMFRAMIKEGCEQEIKWG 282

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC  +G EPL++ + E P    W+S+  +    K
Sbjct: 283 HYVIGDDIPGLNKQMITDYIQYLGNLRCENLGFEPLYEGHREEPASMSWVSQYSNANLIK 342

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + +
Sbjct: 343 TDFFEAKSTAYAKSSAM 359


>gi|1710398|sp|P50650|RIR2_PLAF4 RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|555613|gb|AAA50170.1| ribonucleotide reductase small subunit [Plasmodium falciparum]
          Length = 349

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + +  + P       +Q  + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------EQIIQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|145580571|pdb|2UW2|A Chain A, Crystal Structure Of Human Ribonucleotide Reductase
           Subunit R2
          Length = 332

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 195 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 247

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 248 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 305

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 306 EKRVGEYQR 314


>gi|4557845|ref|NP_001025.1| ribonucleoside-diphosphate reductase subunit M2 isoform 2 [Homo
           sapiens]
 gi|400979|sp|P31350|RIR2_HUMAN RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|36155|emb|CAA42181.1| small subunit ribonucleotide reductase [Homo sapiens]
 gi|251637|gb|AAA09577.1| ribonucleotide reductase R2 subunit [Homo sapiens]
 gi|12804875|gb|AAH01886.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|14029165|gb|AAK51163.1| ribonucleotide reductase M2 subunit [Homo sapiens]
 gi|20988810|gb|AAH30154.1| Ribonucleotide reductase M2 polypeptide [Homo sapiens]
 gi|62702173|gb|AAX93099.1| unknown [Homo sapiens]
 gi|123981920|gb|ABM82789.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|123996753|gb|ABM85978.1| ribonucleotide reductase M2 polypeptide [synthetic construct]
 gi|189053955|dbj|BAG36462.1| unnamed protein product [Homo sapiens]
 gi|261861600|dbj|BAI47322.1| ribonucleotide reductase M2 [synthetic construct]
          Length = 389

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 252 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 305 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 362

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 363 EKRVGEYQR 371


>gi|149728153|ref|XP_001502384.1| PREDICTED: similar to Ribonucleoside-diphosphate reductase subunit
           M2 (Ribonucleotide reductase small subunit)
           (Ribonucleotide reductase small chain) [Equus caballus]
          Length = 425

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 288 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVKEIIINAVRIEQEFL 340

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 341 TEALPVRLIGMNCALMKQYIEFVADRLLLELGFNKVFR-VENPFDFM-ENISLEGKTNFF 398

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 399 EKRVGEYQR 407


>gi|321263951|ref|XP_003196693.1| ribonucleotide reductase small subunit [Cryptococcus gattii WM276]
 gi|317463170|gb|ADV24906.1| Ribonucleotide reductase small subunit, putative [Cryptococcus
           gattii WM276]
          Length = 430

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 70/130 (53%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + N       HL  +    +   ++ EA ++E  + 
Sbjct: 282 MPGLTFSNELISRDEGMHTDFACLLYN-------HLKHRCSTDEVHRIVSEALVIEKQFL 334

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QYM+F+A+R    +G   ++  T NPF WM E+I L+ + NFF
Sbjct: 335 TDALPCALIGINAHLMCQYMEFVADRLVVDLGYPKIYNAT-NPFDWM-ELISLQGKANFF 392

Query: 121 ETRVTEYQQG 130
           E+RV+ YQ+ 
Sbjct: 393 ESRVSAYQKA 402


>gi|73979721|ref|XP_540076.2| PREDICTED: similar to Ribonucleoside-diphosphate reductase M2 chain
           (Ribonucleotide reductase small chain) isoform 1 [Canis
           familiaris]
          Length = 394

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVKEIIINAVRIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 310 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 367

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 368 EKRVGEYQR 376


>gi|297668213|ref|XP_002812343.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Pongo abelii]
          Length = 449

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 312 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 364

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 365 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 422

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 423 EKRVGEYQR 431


>gi|260064013|ref|NP_001159403.1| ribonucleoside-diphosphate reductase subunit M2 isoform 1 [Homo
           sapiens]
          Length = 449

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 312 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 364

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 365 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 422

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 423 EKRVGEYQR 431


>gi|119621373|gb|EAX00968.1| hCG23833, isoform CRA_b [Homo sapiens]
 gi|119621374|gb|EAX00969.1| hCG23833, isoform CRA_b [Homo sapiens]
          Length = 449

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 312 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRIEQEFL 364

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 365 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 422

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 423 EKRVGEYQR 431


>gi|70936723|ref|XP_739266.1| ribonucleotide reductase small subunit [Plasmodium chabaudi
           chabaudi]
 gi|56516136|emb|CAH80811.1| ribonucleotide reductase small subunit, putative [Plasmodium
           chabaudi chabaudi]
          Length = 349

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 74/129 (57%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + ++ + P       ++  + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLENKLP-------EEVVQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKVF-HSKNPFSWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|226528734|ref|NP_001150842.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
 gi|195642302|gb|ACG40619.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++        K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYELLR-------NKLDEARVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++  T NPF WM E+I L  + NFF
Sbjct: 250 CDALPVALVGMNGDLMSQYIEFVADRLLMALGCKKMYNVT-NPFDWM-ELISLMGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 308 EKRVGDYQKAS 318


>gi|212697417|ref|ZP_03305545.1| hypothetical protein ANHYDRO_01987 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325846383|ref|ZP_08169352.1| ribonucleoside-diphosphate reductase, beta subunit [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
 gi|212675609|gb|EEB35216.1| hypothetical protein ANHYDRO_01987 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325481567|gb|EGC84607.1| ribonucleoside-diphosphate reductase, beta subunit [Anaerococcus
           hydrogenalis ACS-025-V-Sch4]
          Length = 352

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 76/140 (54%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN +K E P L+T E ++   ++L E    EIA+ 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSMINDLKEERPDLFTDELKEFYLSLLKEGVEQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN+   E Y++++ N R   +GL  +++ Y E P    W+SE  D  + K
Sbjct: 272 KYAIGDEIQGLNSQMIEDYIKYLGNLRAKGLGLGKIYEGYEEEPQSMKWVSEYSDPNQVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +V+ Y + + ++ D
Sbjct: 332 TDFFEGKVSAYSKSSVIEDD 351


>gi|149408710|ref|XP_001506085.1| PREDICTED: similar to 5,10-methenyltetrahydrofolate synthetase
           [Ornithorhynchus anatinus]
          Length = 394

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ + ++  A  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVKEIIINAVRIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK  ENPF +M E I L+ + NFF
Sbjct: 310 TEALPVKLIGMNCTLMKQYIEFVADRLLLELGFSKIFK-VENPFDFM-ENISLEGKTNFF 367

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 368 EKRVGEYQR 376


>gi|52077136|dbj|BAD46182.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|52077275|dbj|BAD46317.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|186920364|gb|ACC95435.1| ribonucleotide diphosphate reductase small subunit 1 [Oryza sativa
           Japonica Group]
          Length = 339

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDEARVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++    NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVALVGMNGDLMSQYIEFVADRLLMALGCKKMYN-VANPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 308 EKRVGDYQKAS 318


>gi|316971821|gb|EFV55552.1| ribonucleotide reductase R2 subunit [Trichinella spiralis]
          Length = 366

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 75/136 (55%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  + + R ++ EA  +E  + 
Sbjct: 229 MPGLTFSNELISRDEGLHCDFACLLYS-------HLKKKPTEDRVRQIITEAVSIEQEFL 281

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++++A+R   ++G   ++  +ENPF +M E+I L+ + NFF
Sbjct: 282 TDALPVRLIGMNCVLMSQYIEYVADRLLVELGCSKVYN-SENPFDFM-EMISLEGKTNFF 339

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 340 EKRVGEYQK-AGVMAD 354


>gi|149194868|ref|ZP_01871962.1| ribonucleotide-diphosphate [Caminibacter mediatlanticus TB-2]
 gi|149135027|gb|EDM23509.1| ribonucleotide-diphosphate [Caminibacter mediatlanticus TB-2]
          Length = 346

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 3/134 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  H     ++  +IK E P L+T E  +  + ML+ A  LE  + 
Sbjct: 207 MLGSAQMIRFIQRDEVTHTLLFANIFKEIKKEFPDLFTPEVIRNIKDMLYAAYELERDWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT--ENPFPWMSEVIDLKKEK- 117
                   +GL+    +++ +++AN+R H +GLE LF     +NP  W        ++K 
Sbjct: 267 FYITNDEILGLSKELIDRFTKYLANKRAHAMGLELLFPEIGLKNPISWFDSFSSFNEQKT 326

Query: 118 NFFETRVTEYQQGA 131
           NFFE  V  Y +G+
Sbjct: 327 NFFEGNVVNYSKGS 340


>gi|75076796|sp|Q4R7Q7|RIR2_MACFA RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|67969020|dbj|BAE00865.1| unnamed protein product [Macaca fascicularis]
          Length = 389

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++ R ++  A  +E  + 
Sbjct: 252 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEERVREIIINAVRVEQEFL 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 305 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 362

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 363 EKRVGEYQR 371


>gi|68069763|ref|XP_676793.1| ribonucleotide reductase small subunit [Plasmodium berghei strain
           ANKA]
 gi|56496646|emb|CAI04349.1| ribonucleotide reductase small subunit, putative [Plasmodium
           berghei]
          Length = 158

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 74/129 (57%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + ++ + P       ++  + ++ EA  +E ++  E
Sbjct: 23  GLTFSNELISRDEGLHTDFNCLIYSLLENKLP-------EEVVQNIVKEAVEVERSFICE 75

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 76  SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKVF-HSKNPFNWM-DLISLQGKTNFFEK 133

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 134 RVADYQKSG 142


>gi|103487260|ref|YP_616821.1| ribonucleotide-diphosphate reductase subunit beta [Sphingopyxis
           alaskensis RB2256]
 gi|98977337|gb|ABF53488.1| Ribonucleoside-diphosphate reductase [Sphingopyxis alaskensis
           RB2256]
          Length = 354

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + +    E   L TK  ++       +   LE A+ 
Sbjct: 178 MKGMGQIVSWSIRDESLHCEGIIKLFHAFTKERGCL-TKAVKEDIIDTCQKTVRLEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                +G V G+     ++Y+++IA+ R  Q+G +P++   E+P PW++ +++  +  NF
Sbjct: 237 DLAFEQGPVPGMTPKEIKRYIRYIADWRLGQLGFQPIYMIDEHPLPWLAPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY +GA
Sbjct: 297 FETRATEYSKGA 308


>gi|291412327|ref|XP_002722439.1| PREDICTED: ribonucleotide reductase M2 polypeptide [Oryctolagus
           cuniculus]
          Length = 400

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 263 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEQRVQEIIVNAVRIEQEFL 315

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 316 TEALPVKLIGMNCALMKQYIEFVADRLLLELGFSKVFR-VENPFDFM-ENISLEGKTNFF 373

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 374 EKRVGEYQR 382


>gi|255323570|ref|ZP_05364700.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           showae RM3277]
 gi|255299284|gb|EET78571.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           showae RM3277]
          Length = 340

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T E + K   M   A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRTERPDLFTPETEAKIYDMFERAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      EQY++++ ++R   IGL+  +    +P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEQYIRYLIDQRLVAIGLKRRYN-VPHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 323 FEAKVTNYSKGS 334


>gi|167760514|ref|ZP_02432641.1| hypothetical protein CLOSCI_02888 [Clostridium scindens ATCC 35704]
 gi|167661880|gb|EDS06010.1| hypothetical protein CLOSCI_02888 [Clostridium scindens ATCC 35704]
          Length = 347

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 73/137 (53%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+T+   ++ R M+ E    EI++ 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFRNILLELKKEEPQLFTESRIEEYREMIKEGCQQEISWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC  +G  P+++ + + P    W+S+  +    K
Sbjct: 267 HYVIGDDIQGLNRDMVTDYIQYLGNLRCTNLGFAPIYEGHVKEPDSMSWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|302833193|ref|XP_002948160.1| hypothetical protein VOLCADRAFT_101784 [Volvox carteri f.
           nagariensis]
 gi|300266380|gb|EFJ50567.1| hypothetical protein VOLCADRAFT_101784 [Volvox carteri f.
           nagariensis]
          Length = 354

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++     I RDE LH +F   +         HL  +  +++   ++ EA  LE  + 
Sbjct: 207 MPGLSFSNCLISRDEGLHCDFACCLYG-------HLKNRLSRERVVKIVDEAVRLEDEFC 259

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+NA    QY++F+A+R    +G +  +  T NPF WM E+I L+ + NFF
Sbjct: 260 TEALSCELLGMNADLMRQYIRFVADRLLVSLGYDKYYN-TVNPFDWM-EMISLQGKANFF 317

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+   +  D
Sbjct: 318 ERRVGEYQRACVMAGD 333


>gi|149721713|ref|XP_001493623.1| PREDICTED: ribonucleotide reductase M2 B (TP53 inducible) [Equus
           caballus]
          Length = 351

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++ R ++  A  +E  + 
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVNAVEIEQEFL 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 267 TEALPVDLIGMNCVLMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFF 324

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 325 EKRVSEYQRFA 335


>gi|126303832|ref|XP_001381111.1| PREDICTED: similar to hCG23833, [Monodelphis domestica]
          Length = 493

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  ++K + ++  A  +E  + 
Sbjct: 356 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSEEKVKEIIINAVRIEQEFL 408

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 409 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKIFR-VENPFDFM-ENISLEGKTNFF 466

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 467 EKRVGEYQR 475


>gi|308184827|ref|YP_003928960.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SJM180]
 gi|308060747|gb|ADO02643.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SJM180]
          Length = 341

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E+++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIEVSWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|46122063|ref|XP_385585.1| hypothetical protein FG05409.1 [Gibberella zeae PH-1]
          Length = 399

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 73/133 (54%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F         + + HL  +  +Q  + ++ +A  +E  + 
Sbjct: 250 MPGLSFSNELISRDEGLHTDFAC-------LLHSHLKGRASKQMIQDIITDAVSIEQEFL 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L  + NFF
Sbjct: 303 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYKST-NPFDFM-ENISLGGKTNFF 360

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 361 EKRVADYQKAGVL 373


>gi|194690416|gb|ACF79292.1| unknown [Zea mays]
 gi|194704028|gb|ACF86098.1| unknown [Zea mays]
 gi|195619132|gb|ACG31396.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
 gi|223943167|gb|ACN25667.1| unknown [Zea mays]
          Length = 339

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESRVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYN-VANPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 308 EKRVGEYQKAS 318


>gi|212274629|ref|NP_001130908.1| hypothetical protein LOC100192012 [Zea mays]
 gi|195636980|gb|ACG37958.1| ribonucleoside-diphosphate reductase small chain [Zea mays]
          Length = 339

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + R ++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESRVREIVADAVDIEREFV 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 250 CDALPVALVGMNGGLMSQYIEFVADRLLMALGHRKMYN-VANPFDWM-ELISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 308 EKRVGEYQKAS 318


>gi|301117384|ref|XP_002906420.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
 gi|262107769|gb|EEY65821.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
          Length = 379

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 76/134 (56%), Gaps = 10/134 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE +H +F   + +++  + P     E  + + T+ HE       + 
Sbjct: 242 MPGLSFSNELISRDEGMHTDFACLLYSKLVTKLPESRVHEIVRDAVTIEHE-------FV 294

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R  + +G+  ++ + +NPF WM ++I L+ + NFF
Sbjct: 295 RDSLPVELIGMNSGLMCQYIEFVADRLLYSLGVSKIY-HAKNPFDWM-DMISLQGKTNFF 352

Query: 121 ETRVTEYQQ-GAGL 133
           E RV EY + G G+
Sbjct: 353 EKRVGEYSKAGVGV 366


>gi|225451453|ref|XP_002269951.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147804660|emb|CAN64484.1| hypothetical protein VITISV_012640 [Vitis vinifera]
          Length = 329

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ ++  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------NKLSEERVKAIVADSVDIEREFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N+    QY++F+A+R    +G   ++  + NPF WM E+I L+ + NFF
Sbjct: 241 CDALPCALVGMNSALMSQYIEFVADRLLGALGYGKMYNVS-NPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 299 EKRVGEYQKAS 309


>gi|225320685|dbj|BAH29738.1| ribonucleoside-diphosphate reductase subunit M2 [Dicyema japonicum]
          Length = 337

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +K + P       + +   ++ EA +LE  + 
Sbjct: 197 MPGLTYSNELISRDEGLHTDFACLLYHHLKKKLP-------RDRILQIITEAVVLEKEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G +  + Y +NPF +M E I L  + NFF
Sbjct: 250 TEALPVALIGMNVNLMSQYIEFVADRLIIELGYDKHY-YAQNPFDFM-ENISLSGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQR 316


>gi|254517517|ref|ZP_05129573.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium sp.
           7_2_43FAA]
 gi|226911266|gb|EEH96467.1| ribonucleotide-diphosphate reductase subunit beta [Clostridium sp.
           7_2_43FAA]
          Length = 344

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    +++ ++++E P ++T E + + + M+  A   EI++ 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNILKELQLEQPEIFTDEVKNQLKEMMKTAVEHEISWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKEK-N 118
           +  +     G+N      Y++++ N R   IGL+ +++ +  NP  W+  + D    K +
Sbjct: 266 NYVIGDNIQGINKNLINDYIKYLGNLRMKAIGLDAIYEGHDNNPAAWVDILSDANSVKTD 325

Query: 119 FFETRVTEYQQGAGL 133
           FFE + T Y +   L
Sbjct: 326 FFEAKSTAYAKAGAL 340


>gi|38232564|gb|AAR15079.1| ribonucleotide reductase R2 subunit variant [Aedes albopictus]
          Length = 219

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  Q++   ++ EA L+E  + 
Sbjct: 82  MPGLTFSNELISRDEGLHTDFACLMF-------KYLVQKPSQERVIEIIREAVLIEQEFL 134

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G++ ++  T+NPF +M E I L+ + NFF
Sbjct: 135 TKALPVDLLGMNCELMSQYIEFVADRLLLELGIDKIYN-TKNPFSFM-EFISLEGKTNFF 192

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 193 EKKVGEYQK 201


>gi|215401441|ref|YP_002332744.1| RR2b [Spodoptera litura nucleopolyhedrovirus II]
 gi|209483982|gb|ACI47415.1| RR2b [Spodoptera litura nucleopolyhedrovirus II]
          Length = 313

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 72/136 (52%), Gaps = 15/136 (11%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVIN---QIKIENPHLWTKEFQQKSRTMLHEATLLEI 57
           M G+    + I RDE LH NF     N     K++ P +           M  EA  +E+
Sbjct: 179 MPGLTFSNELISRDEGLHTNFACLYYNTRVDQKLDVPTV---------SDMFAEAVAIEM 229

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P+  VG+NA    +Y++F+A+R   Q+   P   +TENPF +M+  I L+ + 
Sbjct: 230 EFFAEALPESLVGMNAEMMRKYIEFVADRLLVQLKY-PKIYHTENPFEFMNN-ISLEGKT 287

Query: 118 NFFETRVTEYQQ-GAG 132
           NFFE RV EY++ GAG
Sbjct: 288 NFFEKRVGEYKRFGAG 303


>gi|167519412|ref|XP_001744046.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778008|gb|EDQ91624.1| predicted protein [Monosiga brevicollis MX1]
          Length = 329

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 76/136 (55%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +K        +  +++   ++ +A  +E  + 
Sbjct: 192 MPGLTFSNELISRDEGLHTDFACLMFSMLK-------KRPSKERVTGIIMDAVEIEQDFL 244

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P G +G+NA   +QY++F+++R    +G E +F  +ENPF +M E I ++ + NFF
Sbjct: 245 TNALPCGLLGMNATLMKQYIEFVSDRLLVALGCEKIFN-SENPFDFM-ESISIEGKTNFF 302

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 303 EKRVGEYQK-AGVMAD 317


>gi|138894466|ref|YP_001124919.1| ribonucleoside-diphosphate reductase subunit beta [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247935|ref|ZP_03146637.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. G11MC16]
 gi|134265979|gb|ABO66174.1| Ribonucleoside-diphosphate reductase beta subunit [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212719|gb|EDY07476.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. G11MC16]
          Length = 344

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E    +R+   +A  LEI +A
Sbjct: 204 MVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELADFARSTFMKAAELEIEWA 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            E +     G++    E Y++F AN R HQ+G + P   Y  NP  W+   E +DL K  
Sbjct: 264 GEIIGNDIDGIDLADLEAYIKFYANVRAHQLGFDRPFDGYRTNPLRWIKAYEEVDLGK-S 322

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 323 DFFEQKPRQYTK 334


>gi|323486976|ref|ZP_08092290.1| hypothetical protein HMPREF9474_04041 [Clostridium symbiosum
           WAL-14163]
 gi|323399688|gb|EGA92072.1| hypothetical protein HMPREF9474_04041 [Clostridium symbiosum
           WAL-14163]
          Length = 347

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL     +I +++ E P L+++E     R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFGSIIRELQTEEPSLFSREKTDCYREMIREGCEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL       Y++++ N RC  +G EPL+  Y   P    W+S+  +    K
Sbjct: 267 CYAIGDEVPGLTKQMITDYIRYLGNLRCSNLGFEPLYDGYAHEPETMAWVSQYSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|163784572|ref|ZP_02179421.1| ribonucleotide-diphosphate [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880158|gb|EDP73813.1| ribonucleotide-diphosphate [Hydrogenivirga sp. 128-5-R1-1]
          Length = 139

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 3/129 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK-EFQQKSRTMLHEATLLEIAY 59
           M  +    + ++ DESLHL  GI+ I  I  ENP +    +F +  R  + +A  LE+ Y
Sbjct: 9   MKNVVSGVELVLIDESLHLQNGIEAILTIIEENPEIVDDIKFVENIRDTIIDAVELELNY 68

Query: 60  AHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
                    + G++    E YM++IA+RR  ++G +P F   +NP  ++ +  D+KK  N
Sbjct: 69  LKTKFGGTTIFGVSYKELEMYMKYIADRRLEELGFDPQFNIQQNPLKFLQKE-DVKKLTN 127

Query: 119 FFETRVTEY 127
           FFE   TEY
Sbjct: 128 FFEVSSTEY 136


>gi|118383611|ref|XP_001024960.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila]
 gi|89306727|gb|EAS04715.1| ribonucleoside-diphosphate reductase, beta subunit family protein
           [Tetrahymena thermophila SB210]
          Length = 376

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 73/130 (56%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +   N  L  +E  +    ++ EA  +E  + 
Sbjct: 239 MPGLTFSNELISRDEGLHTDFACLLYSML---NKKLTKEEIYE----IITEAVEIEKEFI 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G+ P F  ++NPF WM ++I ++ + NFF
Sbjct: 292 SEALPVELIGMNSNMMKQYLEFVADRLLFALGV-PKFYNSKNPFEWM-DMISIQGKTNFF 349

Query: 121 ETRVTEYQQG 130
           E RV EYQ+ 
Sbjct: 350 EKRVGEYQKA 359


>gi|32266105|ref|NP_860137.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           hepaticus ATCC 51449]
 gi|32262154|gb|AAP77203.1| ribonucleoside diphosphate reductase [Helicobacter hepaticus ATCC
           51449]
          Length = 349

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++I+ ++ E  HL+T   +++   M  +A  +E  + 
Sbjct: 213 MLGSAQMIRFIQRDEVTHLLLFQNMISSLRKEQGHLFTPSLEEEVVEMFKKAVEIESQWG 272

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +    +Y+Q++A+ R   +GL  L+  ++NP  W+ +      +K NF
Sbjct: 273 EYITQGQILGLTSEIIREYIQYLADARLKAVGLPQLYG-SKNPIKWVDQFASFNDQKTNF 331

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 332 FEAKVTNYSKGS 343


>gi|330804590|ref|XP_003290276.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
 gi|325079602|gb|EGC33194.1| hypothetical protein DICPUDRAFT_56591 [Dictyostelium purpureum]
          Length = 335

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 72/131 (54%), Gaps = 13/131 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQI--KIENPHLWTKEFQQKSRTMLHEATLLEIA 58
           M G+    + I RDE LH NF   +  ++  K+E+  L           ++ +A + E  
Sbjct: 189 MPGLTFSNELISRDEGLHCNFACLLYTKLINKLESKTL---------EAIIRDAVVCEKE 239

Query: 59  YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
           +  +++P   +G+N+ S  QY++F A+R    +G + ++  + NPF WM E+I L+++ N
Sbjct: 240 FICDSLPVDLIGMNSRSMSQYIEFCADRLLVSLGYKKIYNAS-NPFDWM-EMISLQRKTN 297

Query: 119 FFETRVTEYQQ 129
           FFE +V EY +
Sbjct: 298 FFEGKVAEYAK 308


>gi|148234092|ref|NP_001079369.1| ribonucleotide reductase M2 B (TP53 inducible) [Xenopus laevis]
 gi|27371032|gb|AAH41209.1| MGC52676 protein [Xenopus laevis]
          Length = 386

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HLIRKPSEERVVELITDAVQIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G + +FK T NPF +M E I L+ + NFF
Sbjct: 302 TEALPVNLIGMNCTLMKQYIEFVADRLLLELGFKKVFKAT-NPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 360 EKKVGEYQK 368


>gi|56118690|ref|NP_001007890.1| ribonucleotide reductase M2, gene 2 [Xenopus (Silurana) tropicalis]
 gi|51258920|gb|AAH80161.1| ribonucleotide reductase M2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 386

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVNKPSEERVVQLITDAVQIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK T NPF +M E I L+ + NFF
Sbjct: 302 TEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKAT-NPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 360 EKKVGEYQK 368


>gi|89268988|emb|CAJ81953.1| ribonucleotide reductase m2 polypeptide [Xenopus (Silurana)
           tropicalis]
 gi|89269815|emb|CAJ81580.1| ribonucleotide reductase m2 polypeptide [Xenopus (Silurana)
           tropicalis]
          Length = 386

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVNKPSEERVVQLITDAVQIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK T NPF +M E I L+ + NFF
Sbjct: 302 TEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKAT-NPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 360 EKKVGEYQK 368


>gi|296282225|ref|ZP_06860223.1| ribonucleotide-diphosphate reductase subunit beta [Citromicrobium
           bathyomarinum JL354]
          Length = 354

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + ++  +     +TK  ++    +  ++  LE  + 
Sbjct: 178 MKGMGQIVSWSVRDESLHCEGIIRLFHEF-VRERDCYTKAVKEDIIDICQKSVRLEDNFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+ A   ++Y+++IA+ R  Q+GL+P++   E+P PW++ +++  +  NF
Sbjct: 237 DLAFEMGPVSGMTAKEIKKYIRYIADWRLGQLGLQPIYMIDEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 297 FEQRATEYSKGA 308


>gi|66822029|ref|XP_644369.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|66823381|ref|XP_645045.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|41019487|sp|P42521|RIR2_DICDI RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|29611978|gb|AAB72227.2| ribonucleotide reductase small subunit [Dictyostelium discoideum]
 gi|60472492|gb|EAL70444.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
 gi|60472997|gb|EAL70945.1| ribonucleotide reductase small subunit [Dictyostelium discoideum
           AX4]
          Length = 338

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 72/130 (55%), Gaps = 11/130 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +  +++ + +P +  K        M+ +A   E  +
Sbjct: 194 MQGLTFSNELISRDEGLHCDFACLLYTKLQRKLDPKVIEK--------MIRDAVECEKEF 245

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             E++P   +G+N+ S  QY++F A+R    +G + +F  + NPF WM E+I L+++ NF
Sbjct: 246 ICESLPVDLIGMNSRSMSQYIEFCADRLVVSLGYKKIFN-SSNPFEWM-EMISLQRKSNF 303

Query: 120 FETRVTEYQQ 129
           FE +V EY +
Sbjct: 304 FEGKVAEYAK 313


>gi|324519017|gb|ADY47264.1| Ribonucleoside-diphosphate reductase small chain [Ascaris suum]
          Length = 376

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 71/136 (52%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  +++   ++ EA  +E  Y 
Sbjct: 239 MPGLTHSNELISRDEGLHRDFACLMFS-------HLKKKPNKERIYEIIREAVKIEQEYL 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N     QY++++A+    ++    L+   ENPF +M+  I ++ + NFF
Sbjct: 292 TEALPVGLIGMNCELMSQYIEYVADHLLTELKCPKLYN-MENPFDFMAR-ISIEAKTNFF 349

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   L  D
Sbjct: 350 EKRVSEYQKAGVLSTD 365


>gi|323692021|ref|ZP_08106269.1| ribonucleoside-diphosphate reductase [Clostridium symbiosum
           WAL-14673]
 gi|323503944|gb|EGB19758.1| ribonucleoside-diphosphate reductase [Clostridium symbiosum
           WAL-14673]
          Length = 347

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL     +I +++ E P L+++E     R M+ E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFGSIIRELQTEEPSLFSREKTDCYREMIREGCEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL       Y++++ N RC  +G EPL+  Y   P    W+S+  +    K
Sbjct: 267 CYAIGDEVPGLTKQMITDYIRYLGNLRCSNLGFEPLYDGYVHEPETMAWVSQYSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|4894211|gb|AAD32302.1| ribonucleotide reductase small subunit [Glycine max]
          Length = 339

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++   P +       +   ++HEA  +E  + 
Sbjct: 198 MPGLTFSNELISRDEGLHCDFACLLYSLLR--KPLI-----SDQVHKLVHEAVEIETEFV 250

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G +  +   ENPF WM E I L+ + NFF
Sbjct: 251 CDALPCALIGMNSVLMSQYIKFVADRLLVALGYQRKYN-VENPFDWM-EFISLQGKANFF 308

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 309 ERRVGDYQKAS 319


>gi|256545921|ref|ZP_05473276.1| ribonucleoside-diphosphate reductase, beta subunit [Anaerococcus
           vaginalis ATCC 51170]
 gi|256398343|gb|EEU11965.1| ribonucleoside-diphosphate reductase, beta subunit [Anaerococcus
           vaginalis ATCC 51170]
          Length = 352

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +IN +K E P L+T E ++   ++L E    EIA+ 
Sbjct: 212 MPGTVQEIRYINRDENTHLWLFRSMINDLKEERPDLFTDELKEFYLSLLKEGVEQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN+   E Y++++ N R   +GL  +++ Y + P    W+SE  D  + K
Sbjct: 272 KYAIGDEIQGLNSQMIEDYIKYLGNLRAKGLGLGTIYEGYEDEPQSMKWVSEYSDPNQVK 331

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +V+ Y + + ++ D
Sbjct: 332 TDFFEGKVSAYSKSSVIEDD 351


>gi|290977320|ref|XP_002671386.1| predicted protein [Naegleria gruberi]
 gi|284084954|gb|EFC38642.1| predicted protein [Naegleria gruberi]
          Length = 338

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 73/130 (56%), Gaps = 8/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   + + +K      +TK  QQ   +++ EA  +E  + 
Sbjct: 200 MPGLAFSNELISRDEGLHTDFACLLYSTLK------FTKLPQQVVHSLVSEAVEIEKEFI 253

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+   +QY++ +A+R    +G + ++  + NPF WM+ +I +  + NFF
Sbjct: 254 CESLPVDLIGMNSRLMQQYIEMVADRLLVSLGYDKIYN-SPNPFDWMN-IISVSGKTNFF 311

Query: 121 ETRVTEYQQG 130
           E +V EY + 
Sbjct: 312 EKKVGEYAKA 321


>gi|157126966|ref|XP_001654749.1| ribonucleoside-diphosphate reductase small chain [Aedes aegypti]
 gi|15638625|gb|AAL05057.1|AF411297_1 ribonucleotide reductase 2 [Aedes aegypti]
 gi|82469974|gb|ABB77235.1| ribonucleotide reductase small subunit R2 [Aedes aegypti]
 gi|108873070|gb|EAT37295.1| ribonucleoside-diphosphate reductase small chain [Aedes aegypti]
          Length = 397

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  Q++   ++ EA L+E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLMFK-------YLVQKPSQERVIEIIREAVLIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G++ ++  T+NPF +M E I L+ + NFF
Sbjct: 313 TKALPVDLLGMNCDLMSQYIEFVADRLLLELGIDKIYN-TKNPFSFM-EFISLEGKTNFF 370

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 371 EKKVGEYQK 379


>gi|159465291|ref|XP_001690856.1| ribonucleoside-diphosphate reductase small subunit [Chlamydomonas
           reinhardtii]
 gi|158279542|gb|EDP05302.1| ribonucleoside-diphosphate reductase small subunit [Chlamydomonas
           reinhardtii]
          Length = 493

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++     I RDE LH +F   + +       HL  +  +++   ++ EA  LE  + 
Sbjct: 348 MPGLSFSNVLISRDEGLHCDFACCLYS-------HLKNRLSRERVLQIVDEAVQLEDEFC 400

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+NA    QY++F+A+R    +G E  +  T NPF WM E+I L+ + NFF
Sbjct: 401 TEALSCELLGMNADLMRQYIRFVADRLLVSLGYEKHYN-TRNPFDWM-EMISLQGKANFF 458

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 459 ERRVGEYQRAG 469


>gi|294945135|ref|XP_002784568.1| ribonucleotide reductase R2 subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239897674|gb|EER16364.1| ribonucleotide reductase R2 subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 238

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + N +       +T+   ++   ++  A  +E  + 
Sbjct: 84  MPGLTFSNELISRDEGLHADFACLLYNMMH------YTRLPDERVHEIVRGAVDVERVFI 137

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    +Y++F+A+R    +G   L+  T NPF WM ++I L+ + NFF
Sbjct: 138 SESLPVSLIGMNSQLMCRYIEFVADRLLVALGHPKLYNAT-NPFDWM-KMISLQGKTNFF 195

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+G 
Sbjct: 196 EKRVGEYQKGG 206


>gi|162147608|ref|YP_001602069.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542240|ref|YP_002274469.1| ribonucleotide-diphosphate reductase subunit beta
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786185|emb|CAP55767.1| putative ribonucleotide reductase small subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209529917|gb|ACI49854.1| Ribonucleoside-diphosphate reductase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 353

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 1/130 (0%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+ +   + +RDE+LH      +      ENP +WT   +     +  +    E A+   
Sbjct: 204 GMGQIVSWSVRDETLHCLSMARLFRVFIQENPEIWTDALRADIVQICRDIVEHEDAFIDL 263

Query: 63  TMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFE 121
               G V GL+    + Y++FIA+RR + +GL+ ++    NP PW+ ++++  +  NFFE
Sbjct: 264 CFEMGPVEGLDGDLVKTYIRFIADRRLNLLGLDGIYDVPSNPLPWVDDMLNAVEHTNFFE 323

Query: 122 TRVTEYQQGA 131
            R TEY + +
Sbjct: 324 NRSTEYSRAS 333


>gi|157164305|ref|YP_001467763.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           concisus 13826]
 gi|112800348|gb|EAT97692.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           concisus 13826]
          Length = 340

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+T E + K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFTPETEAKIYDMFEKAGNLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      EQY+ ++ ++R   IGL+  +    +P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEQYIHYLIDQRLVAIGLKRKYN-VAHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE +VT Y +G+
Sbjct: 323 FEAKVTNYSKGS 334


>gi|82538850|ref|XP_723858.1| ribonucleotide reductase small chain [Plasmodium yoelii yoelii str.
           17XNL]
 gi|145580416|pdb|2P1I|A Chain A, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580417|pdb|2P1I|B Chain B, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580418|pdb|2P1I|C Chain C, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580419|pdb|2P1I|D Chain D, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580420|pdb|2P1I|E Chain E, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580421|pdb|2P1I|F Chain F, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580422|pdb|2P1I|G Chain G, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|145580423|pdb|2P1I|H Chain H, Plasmodium Yoelii Ribonucleotide Reductase Subunit R2
           (Py03671)
 gi|23478298|gb|EAA15423.1| Ribonucleotide reductase, small chain [Plasmodium yoelii yoelii]
          Length = 349

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + ++ + P       +   + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLENKLP-------ENVVQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKVF-HSKNPFNWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|283768723|ref|ZP_06341634.1| ribonucleoside-diphosphate reductase, beta subunit [Bulleidia
           extructa W1219]
 gi|283104509|gb|EFC05882.1| ribonucleoside-diphosphate reductase, beta subunit [Bulleidia
           extructa W1219]
          Length = 348

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ +++ E P L+T    Q  + M+HE    EIA+ 
Sbjct: 208 MPGSVQEIRYINRDENTHLWLFRNILLELQKEEPELFTDSNIQMIKDMIHEGVQQEIAWG 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN+   E Y++++ N R   +GL  L++ Y E P    W+ +  D    K
Sbjct: 268 QYVIGNNIPGLNSQMVEDYIKYLGNTRFATLGLGNLYEGYEEEPETMRWVKQYSDANMVK 327

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE RVT Y + + ++ D
Sbjct: 328 TDFFEARVTAYAKSSAIEDD 347


>gi|224046583|ref|XP_002198998.1| PREDICTED: hypothetical protein [Taeniopygia guttata]
          Length = 362

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  +  +++   ++  A  +E  + 
Sbjct: 225 MPGLTFSNELISRDEGLHCDFACLMFH-------YLVNRPSEERVCEIIVNAVEIEQEFL 277

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P G +G+N    +QY++F+A+R   ++G   +F   ENPF +M E I L+ + NFF
Sbjct: 278 TEALPVGLIGMNCTLMKQYIEFVADRLLMELGFSKVFN-VENPFDFM-ENISLEGKTNFF 335

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 336 EKRVSEYQRFA 346


>gi|322693757|gb|EFY85606.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           acridum CQMa 102]
          Length = 411

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + + HL  +  +Q    ++ +A  +E  + 
Sbjct: 261 MPGLTFSNELISRDEGLHTDFAC-------LLHSHLKNRASKQIIHDIITDAVAIEKEFL 313

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L  + NFF
Sbjct: 314 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYK-TSNPFDFM-ENISLGGKTNFF 371

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 372 EKRVGDYQKAGVL 384


>gi|55742360|ref|NP_001007164.1| ribonucleoside-diphosphate reductase subunit M2 B [Danio rerio]
 gi|29561808|emb|CAD87804.1| novel protein similar to vertebrate ribonucleotide reductase M2 B
           (TP53 inducible) (RRM2B) [Danio rerio]
          Length = 349

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH NF   +I    ++ P +       +   ++ +A  +E  + 
Sbjct: 212 MPGLTYSNELISRDEGLHCNFAC-LIYSYLVKKPSV------DRVNDIIAKAVSIEQEFL 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R    +GL P    +ENPF +M E I L+ + NFF
Sbjct: 265 TEALPVNLIGMNCSLMKQYIEFVADRLLTDLGL-PKAYCSENPFDFM-ESISLEGKTNFF 322

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 323 EKRVAEYQR 331


>gi|332045030|gb|EGI81223.1| Ribonucleoside-diphosphate reductase [Lacinutrix algicola 5H-3-7-4]
          Length = 327

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 72/133 (54%), Gaps = 8/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       +   HL  K  +++ R +L +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDFAV------HLHEHHLINKVPKERIREILVDALNIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+ +     +G E  +  T NPF +M ++I L+ + NFF
Sbjct: 241 TESLPVSLIGMNSKLMSQYLEFVTDGLLQDLGCEKEYG-TANPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGL 133
           E RV+EYQ+   L
Sbjct: 299 EKRVSEYQKAGVL 311


>gi|154174558|ref|YP_001409201.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           curvus 525.92]
 gi|112803525|gb|EAU00869.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           curvus 525.92]
          Length = 340

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T E ++K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRAERSDLFTPEMEEKIYDMFEKAGNLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   IGL+  +   ++P  W+ +      +K NF
Sbjct: 264 RYITQNQIMGFTDDIIEEYIHYLVDQRLVAIGLKRKYN-AKHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|73974202|ref|XP_858105.1| PREDICTED: similar to ribonucleotide reductase M2 B (TP53
           inducible) isoform 4 [Canis familiaris]
          Length = 374

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 78/147 (53%), Gaps = 18/147 (12%)

Query: 1   MVGIAEQYQYIMRDESLHLNFG-------IDVINQIKIENPHLWTKEFQQKSRT--MLHE 51
           M G+    + I RDE LH +F        ++  ++ ++    +   E +Q SR   M+  
Sbjct: 214 MPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVNAVEIEQVSREAYMIST 273

Query: 52  ATLLEIA-------YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF 104
           +  LEIA       +  E +P G +G+N    +QY++F+A+R   ++G   +F+  ENPF
Sbjct: 274 SLFLEIATCRSKHEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFSKVFQ-AENPF 332

Query: 105 PWMSEVIDLKKEKNFFETRVTEYQQGA 131
            +M E I L+ + NFFE RV EYQ+ A
Sbjct: 333 DFM-ENISLEGKTNFFEKRVAEYQRFA 358


>gi|929959|gb|AAA74020.1| ribonuleotide reductase small subunit [Urechis caupo]
          Length = 399

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  Q++   ++ +A  +E ++ 
Sbjct: 259 MPGLTFSNELISRDEGLHCDFACLMFS-------HLKNKPSQERVYDIIRDAVRIEQSFL 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G  P     ENPF +M   I L+ + NFF
Sbjct: 312 TEALPVNLIGMNCKLMAQYIEFVADRLLLELGC-PKIWNVENPFDFMDN-ISLEGKTNFF 369

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 370 EKRVGEYQK 378


>gi|109947017|ref|YP_664245.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           acinonychis str. Sheeba]
 gi|109714238|emb|CAJ99246.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           acinonychis str. Sheeba]
          Length = 341

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLIDEVIEMFKKAVKIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|45268714|dbj|BAD12266.1| p53-inducible ribonucleotide reductase small subunit 2 short form
           gamma [Homo sapiens]
          Length = 139

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 69/119 (57%), Gaps = 9/119 (7%)

Query: 13  RDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLN 72
           +DE LH +F   +         +L  K  +++ R ++ +A  +E  +  E +P G +G+N
Sbjct: 14  QDEGLHCDFACLMFQ-------YLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMN 66

Query: 73  APSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 131
               +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFFE RV+EYQ+ A
Sbjct: 67  CILMKQYIEFVADRLLVELGFSKVFQ-AENPFDFM-ENISLEGKTNFFEKRVSEYQRFA 123


>gi|209877302|ref|XP_002140093.1| ribonucleotide-diphosphate reductase, small subunit
           [Cryptosporidium muris RN66]
 gi|209555699|gb|EEA05744.1| ribonucleotide-diphosphate reductase, small subunit, putative
           [Cryptosporidium muris RN66]
          Length = 346

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +FG  +   +    P+   +E       ++ EA  +E A+ 
Sbjct: 209 MPGLTFSNELISRDEGIHADFGCLLYKTLNNRLPYGRVQE-------IIAEAVEVERAFL 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R    + +  ++  T NPF WM ++I L+ + NFF
Sbjct: 262 CDSLPVDLIGMNSRLMAQYIEFVADRLLFALDVPKIYNVT-NPFDWM-DLISLQGKTNFF 319

Query: 121 ETRVTEYQQGA 131
           E RV EYQ   
Sbjct: 320 EKRVAEYQMAG 330


>gi|322709430|gb|EFZ01006.1| ribonucleoside-diphosphate reductase M2 subunit [Metarhizium
           anisopliae ARSEF 23]
          Length = 414

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + + HL  +  +Q    ++ +A  +E  + 
Sbjct: 264 MPGLTFSNELISRDEGLHTDFAC-------LLHSHLKNRASKQVIYDIITDAVAIEQEFL 316

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G E ++K T NPF +M E I L  + NFF
Sbjct: 317 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYK-TSNPFDFM-ENISLGGKTNFF 374

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 375 EKRVGDYQKAGVL 387


>gi|221060582|ref|XP_002260936.1| ribonucleotide reductase small subunit [Plasmodium knowlesi strain
           H]
 gi|193811010|emb|CAQ42908.1| ribonucleotide reductase small subunit,putative [Plasmodium
           knowlesi strain H]
          Length = 349

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + ++ + P       ++  + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLENKLP-------EEVVQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F + +NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGSRKIF-HAKNPFNWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|302904131|ref|XP_003049009.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729943|gb|EEU43296.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 389

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 72/133 (54%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + + HL  +  +Q  + ++ +A  +E  + 
Sbjct: 240 MPGLTFSNELISRDEGLHTDFAC-------LLHSHLKGRASKQVIQDIITDAVTIEQEFL 292

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA   +QY++F+A+R    +G E ++K + NPF +M E I L  + NFF
Sbjct: 293 TEALPCALLGMNADLMKQYIEFVADRLLVALGNEKVYK-SANPFDFM-ENISLGGKTNFF 350

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 351 EKRVGDYQKAGVL 363


>gi|294890631|ref|XP_002773236.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239878288|gb|EER05052.1| ribonucleotide reductase small subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 350

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + N +       +T+   ++   ++  A  +E  + 
Sbjct: 196 MPGLTFSNELISRDEGLHADFACLLYNMMH------YTRLPDERVHEIVRGAVDVERVFI 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    +Y++F+A+R    +G   L+  T NPF WM ++I L+ + NFF
Sbjct: 250 SESLPVSLIGMNSQLMCRYIEFVADRLLVALGHPKLYNAT-NPFDWM-KMISLQGKTNFF 307

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+G 
Sbjct: 308 EKRVGEYQKGG 318


>gi|291220709|ref|XP_002730368.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 402

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  QQ+   ++ +A  +E  + 
Sbjct: 265 MPGLTFSNELISRDEGLHCDFACLMFS-------HLTNKPSQQRIIEIIRDAVKIEQEFL 317

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    +QY++F+A+R    +G   ++   ENPF +M E I L+ + NFF
Sbjct: 318 TDALPVSLIGMNKDLMKQYIEFVADRLLLDLGCNKIYN-KENPFDFM-ENISLEGKTNFF 375

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 376 EKRVGEYQK 384


>gi|291165654|gb|EFE27703.1| ribonucleoside-diphosphate reductase, beta subunit [Filifactor
           alocis ATCC 35896]
          Length = 348

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I ++K E P L+T E  +  R M+ +    EI +A
Sbjct: 208 MPGTVQEIRYINRDENSHLWLFRSIILELKKEEPELFTPENIEVFRNMIRQGVEEEIKWA 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           +  +     GL     E Y++++ N RC  +G EP+++ Y   P    W+SE  D    K
Sbjct: 268 NYVIGDHIKGLTMQMVEDYLKYLGNLRCRGLGFEPIYEGYQREPESMSWVSEYSDPNAIK 327

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +V+ Y + + ++ D
Sbjct: 328 TDFFEGKVSAYAKSSVIEDD 347


>gi|317011285|gb|ADU85032.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori SouthAfrica7]
          Length = 341

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLIDEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|298713498|emb|CBJ27053.1| Ribonucleoside-diphosphate reductase small chain [Ectocarpus
           siliculosus]
          Length = 504

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++        K  ++    ++ EA  +E ++ 
Sbjct: 362 MPGLTFSNEMISRDEGLHCDFACQLFASLE-------NKPSRETVMAIVREAVEVEKSFI 414

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+NA    QY++F+A+R    +G    +  T+NPF WM ++I L+ + NFF
Sbjct: 415 CGALPCSLIGMNAGVMSQYIEFVADRLLGSLGYGKSYG-TQNPFDWM-DLISLQGKTNFF 472

Query: 121 ETRVTEYQQG 130
           E RV EYQ+ 
Sbjct: 473 EKRVGEYQKA 482


>gi|317014473|gb|ADU81909.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Gambia94/24]
          Length = 341

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKIYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|266918|sp|P07201|RIR2_SPISO RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit;
           AltName: Full=p41
 gi|10342|emb|CAA38919.1| M2 (small) subunit of ribonucleotide reductase [Spisula
           solidissima]
          Length = 384

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  Q++   ++ EA  +E  + 
Sbjct: 244 MPGLTFSNELISRDEGLHCDFACLMFS-------HLVNKPSQERIHQIIDEAVKIEQVFL 296

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++  + L+   ENPF +M E I L+ + NFF
Sbjct: 297 TEALPCRLIGMNCDLMRQYIEFVADRLLLELKCDKLYN-KENPFDFM-EHISLEGKTNFF 354

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 355 EKRVGEYQK 363


>gi|10344|emb|CAA26307.1| unnamed protein product [Spisula solidissima]
          Length = 300

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  Q++   ++ EA  +E  + 
Sbjct: 160 MPGLTFSNELISRDEGLHCDFACLMFS-------HLVNKPSQERIHQIIDEAVKIEQVFL 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++  + L+   ENPF +M E I L+ + NFF
Sbjct: 213 TEALPCRLIGMNCDLMRQYIEFVADRLLLELKCDKLYN-KENPFDFM-EHISLEGKTNFF 270

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 271 EKRVGEYQK 279


>gi|27923845|sp|Q9QTF2|RIR2_RSIV RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|5688956|dbj|BAA82755.1| ribonucleotide reductase small subunit [Red sea bream iridovirus]
 gi|327396894|dbj|BAK14260.1| ribonucleotide diphosphate reductase small subunit [Red sea bream
           iridovirus]
          Length = 312

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   +  Q+         K  Q  +  ++ +A  +E A+ 
Sbjct: 176 MPGLAFSNELISRDEGLHCDFACMLFRQMA-------NKPCQDDAHQIISDAVDIETAFF 228

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S + Y+QF+A+R    +G   ++  + NPF +M   I ++ + NFF
Sbjct: 229 REALKTPLLGMNSDSMKLYIQFVADRLLDALGYAKMYNVS-NPFDFMDN-ISIEGKTNFF 286

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 287 ERRVSEYQR 295


>gi|145553335|ref|XP_001462342.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124430181|emb|CAK94969.1| unnamed protein product [Paramecium tetraurelia]
          Length = 355

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   HL  K   Q+   ++  A  +E  + 
Sbjct: 218 MPGLTFSNELISRDEGLHTDFAC-------LLYKHLVNKMSNQRIHEIISSAVEIEKEFI 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G   ++  ++NPF WM ++I L+ + NFF
Sbjct: 271 SEALPVELIGMNSNLMKQYIEFVADRLIFALGAPKIYN-SKNPFEWM-DMISLQGKTNFF 328

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 329 ERRVGDYQKAG 339


>gi|85710107|ref|ZP_01041172.1| ribonucleotide reductase beta subunit [Erythrobacter sp. NAP1]
 gi|85688817|gb|EAQ28821.1| ribonucleotide reductase beta subunit [Erythrobacter sp. NAP1]
          Length = 346

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  +     E     TK  ++    +  +   LE A+ 
Sbjct: 178 MKGMGQIVSWSVRDETLHCE-GIIKMFHTFCEERDCLTKAVKEDIIDICQKTVRLEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+ A   ++Y+++IA+ R  Q+ L+P++   E+P PW+S +++  +  NF
Sbjct: 237 DLAFEMGPVEGMTAKDIKKYIRYIADWRLGQLNLQPIYMIDEHPLPWLSPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 297 FEARATEYSKGA 308


>gi|315586979|gb|ADU41360.1| ribonucleotide-diphosphate reductase beta subunit [Helicobacter
           pylori 35A]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|312889900|ref|ZP_07749444.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
 gi|311297432|gb|EFQ74557.1| Ribonucleoside-diphosphate reductase [Mucilaginibacter paludis DSM
           18603]
          Length = 343

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 72/136 (52%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H  F   + + +         K  ++   T++ +A  +E  + 
Sbjct: 205 MPGLTFSNELISRDEGMHCEFACLLYSMLS-------NKLSKEAVTTIIADAVEIEKEFV 257

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R   ++G + L+  T NPF +M E+I L+ + NFF
Sbjct: 258 TDALPVNLIGMNAKLMSQYIEFVADRWLQELGYDKLYHAT-NPFDFM-EMISLQGKTNFF 315

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV +YQ+   L  D
Sbjct: 316 EKRVGDYQKSGVLNND 331


>gi|210135249|ref|YP_002301688.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori P12]
 gi|210133217|gb|ACJ08208.1| ribonucleoside-diphosphate reductase 1 beta subunit [Helicobacter
           pylori P12]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|49899161|gb|AAH75746.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
          Length = 386

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL +K  ++  + ++  A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HLISKPSEETVKKIIMNAVEIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    +QY++F+A+R   ++G + +++  ENPF +M E I L+ + NFF
Sbjct: 302 TDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYR-VENPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 360 EKRVGEYQR 368


>gi|319655055|ref|ZP_08009124.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           2_A_57_CT2]
 gi|317393250|gb|EFV74019.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           2_A_57_CT2]
          Length = 345

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++  + +  +I  ENP L T E  +  +     A  LEI +A
Sbjct: 205 MVATSTMINYINRDEQIHVDLFVKIFKEILQENPELNTNELSKFVQETFKRAAELEIEWA 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            + +     G+     E Y++F AN RC+Q+G E P   Y  NP  W+   E +D  K  
Sbjct: 265 RDVIGSKTEGILLSDVEAYIKFYANIRCNQLGYERPFEGYRTNPLRWIVAYEQVDHGK-S 323

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 324 DFFEQKSRQYTK 335


>gi|297380266|gb|ADI35153.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori v225d]
 gi|308062365|gb|ADO04253.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Cuz20]
 gi|317180823|dbj|BAJ58609.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F32]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|188527870|ref|YP_001910557.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Shi470]
 gi|188144110|gb|ACD48527.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Shi470]
 gi|308063873|gb|ADO05760.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Sat464]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|308183194|ref|YP_003927321.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori PeCan4]
 gi|308065379|gb|ADO07271.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori PeCan4]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|317178607|dbj|BAJ56395.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F30]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|254779643|ref|YP_003057749.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori B38]
 gi|254001555|emb|CAX29573.1| Ribonucleoside-diphosphate reductase subunit beta (Ribonucleotide
           reductase small subunit) [Helicobacter pylori B38]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|126662515|ref|ZP_01733514.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
 gi|126625894|gb|EAZ96583.1| ribonucleoside-diphosphate reductase 1, beta subunit [Flavobacteria
           bacterium BAL38]
          Length = 325

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 75/136 (55%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + + H+  K  +++   ++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGMHCDFAV------HLHSHHIVNKVPKERITEIIVDALNIERQFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++G + ++  + NPF +M ++I L+ + NFF
Sbjct: 240 TESLPVSLIGMNATLMTQYLEFVTDRLLVELGCDRVYN-SSNPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+   +  D
Sbjct: 298 EKRVAEYQKAGVMNSD 313


>gi|15612081|ref|NP_223733.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori J99]
 gi|11387046|sp|Q9ZKC3|RIR2_HELPJ RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|4155613|gb|AAD06604.1| RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE 1 BETA CHAIN [Helicobacter
           pylori J99]
 gi|307637755|gb|ADN80205.1| Ribonucleotide reductase of classIa beta subunit [Helicobacter
           pylori 908]
 gi|325996356|gb|ADZ51761.1| Ribonucleotide reductase of class Ia beta subunit [Helicobacter
           pylori 2018]
 gi|325997944|gb|ADZ50152.1| Ribonucleosidase diphosphate reductase beta subunit [Helicobacter
           pylori 2017]
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|187903099|ref|YP_001883390.1| ribonucleoside diphosphate reductase small subunit, rr2 [Musca
           domestica salivary gland hypertrophy virus]
 gi|187384748|gb|ACD03521.1| ribonucleoside diphosphate reductase small subunit, rr2 [Musca
           domestica salivary gland hypertrophy virus]
          Length = 343

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 71/129 (55%), Gaps = 8/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F + +  +  +  P       +++   ++ EA  +E  + 
Sbjct: 199 MPGLTFSNELISRDEGMHCDFAVLLFKRYLVNRPS------EERVGEIVREAVTIEQEFL 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R    +G++ ++  T+NPF +M ++I L  + NFF
Sbjct: 253 TDALPVSLIGMNCGLMSQYIEFVADRLLVDLGMKRIYN-TKNPFDFM-DMISLDGKTNFF 310

Query: 121 ETRVTEYQQ 129
           E RV +YQ+
Sbjct: 311 EKRVGDYQR 319


>gi|261838422|gb|ACX98188.1| ribonucleoside-diphosphate reductase 1 beta subunit [Helicobacter
           pylori 51]
          Length = 341

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|170664480|gb|ACB28637.1| small subunit ribonucleotide reductase [Myxoma virus]
 gi|170664652|gb|ACB28808.1| small subunit ribonucleotide reductase [recombinant virus
           6918VP60-T2]
          Length = 322

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K   P       +++  +++ EA ++E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCDFACLMFKHLK-HTPS------EERVASIIKEAVVIEQRFL 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G   +F  T NPF +M E I L+ + NFF
Sbjct: 239 TEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSAT-NPFDFM-ENISLEGKTNFF 296

Query: 121 ETRVTEYQQ 129
           E RV++YQ+
Sbjct: 297 EKRVSDYQR 305


>gi|28393533|gb|AAO42187.1| putative ribonucleoside-diphosphate reductase small chain
           [Arabidopsis thaliana]
          Length = 243

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++       TK  + + + ++ +A  +E  + 
Sbjct: 99  MPGLTFSNELISRDEGLHCDFACLIYSLLR-------TKFDEDRLKAIVCDAVEIEREFV 151

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +    VG+N     QY++F+A+R    +G   ++  T NPF WM E+I L+ + NFF
Sbjct: 152 CDALSCALVGMNRELMSQYIEFVADRLLAALGCGKVYGVT-NPFDWM-ELISLQGKTNFF 209

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 210 EKRVGEYQKAS 220


>gi|292658982|gb|ADE34370.1| ribonucleotide reductase small chain [Turbot reddish body
           iridovirus]
          Length = 312

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   +  Q+         K  Q+ +  ++ +A  +E A+ 
Sbjct: 176 MPGLAFSNELISRDEGLHCDFACMLFRQMA-------NKPSQEDAHQIISDAVDIETAFF 228

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S   Y+QF+A+R    +G   ++    NPF +M   I ++ + NFF
Sbjct: 229 REALKTPLLGMNSDSMRLYIQFVADRLLDALGYAKMYN-VANPFDFMDN-ISIEGKTNFF 286

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 287 ERRVSEYQR 295


>gi|9633651|ref|NP_051729.1| ribonucleotide reductase, small subunit [Myxoma virus]
 gi|6523870|gb|AAF14903.1|AF170726_19 ribonucleotide reductase, small subunit [Myxoma virus]
 gi|301134541|gb|ADK63655.1| M015L [Myxoma virus]
          Length = 322

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K   P       +++  +++ EA ++E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCDFACLMFKHLK-HTPS------EERVASIIKEAVVIEQRFL 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G   +F  T NPF +M E I L+ + NFF
Sbjct: 239 TEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSAT-NPFDFM-ENISLEGKTNFF 296

Query: 121 ETRVTEYQQ 129
           E RV++YQ+
Sbjct: 297 EKRVSDYQR 305


>gi|330837704|ref|YP_004412345.1| ribonucleotide reductase [Spirochaeta coccoides DSM 17374]
 gi|329749607|gb|AEC02963.1| ribonucleotide reductase [Spirochaeta coccoides DSM 17374]
          Length = 360

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 70/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     ++ +++ E P ++T     + R M+ +    EIA+ 
Sbjct: 220 MPGSVQEIRYINRDETTHLWLFRSILREMQKEEPAMFTPNLVDEYRAMIKQGADQEIAWG 279

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           H  +    VGLN      Y+Q++ N RC  +G +P+++ + + P    W+ +  +    K
Sbjct: 280 HYVIGDDIVGLNKDMVTDYIQYLGNLRCTDLGFQPIYEGHDKEPETMKWVGQYSNANLIK 339

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y +   L
Sbjct: 340 TDFFEARNTAYAKSTSL 356


>gi|145352915|ref|XP_001420779.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581014|gb|ABO99072.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 346

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +  ENP L  K   Q    ++ +A  +E  + 
Sbjct: 208 MRGLTFSNELISRDEGLHCDFACLLYSML--ENP-LSEKVLHQ----LVGDAVTIEKEFV 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +    VG+NA     Y++F+A+R   Q+G+  L+    NPF WM E+I L+ + NFF
Sbjct: 261 CDALSCSLVGMNANMMSTYIEFVADRLLLQLGVSKLYNAV-NPFDWM-ELISLQGKANFF 318

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 319 EHRVDQYQKAG 329


>gi|79160106|gb|AAI08038.1| Rrm2b protein [Danio rerio]
          Length = 349

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH NF         +   +L  K    +   ++ +A  +E  + 
Sbjct: 212 MPGLTYSNELISRDEGLHCNFAC-------LMYSYLVKKPSVDRVNDIIAKAVSIEQEFL 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R    +GL P    +ENPF +M E I L+ + NFF
Sbjct: 265 TEALPVNLIGMNCSLMKQYIEFVADRLLTDLGL-PKAYCSENPFDFM-ESISLEGKTNFF 322

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 323 EKRVAEYQR 331


>gi|115466138|ref|NP_001056668.1| Os06g0127900 [Oryza sativa Japonica Group]
 gi|55296211|dbj|BAD67929.1| putative ribonucleotide reductase R2 [Oryza sativa Japonica Group]
 gi|113594708|dbj|BAF18582.1| Os06g0127900 [Oryza sativa Japonica Group]
 gi|186920368|gb|ACC95437.1| ribonucleotide diphosphate reductase small subunit 2 [Oryza sativa
           Japonica Group]
 gi|215706414|dbj|BAG93270.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222634884|gb|EEE65016.1| hypothetical protein OsJ_19968 [Oryza sativa Japonica Group]
          Length = 345

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + + ++ +A  +E  + 
Sbjct: 203 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESRVQEIVADAVDIEREFV 255

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++    NPF WM E+I L+ + NFF
Sbjct: 256 CDALPVALVGMNGELMSQYIEFVADRLLMALGCKKMYN-VANPFDWM-ELISLQGKTNFF 313

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 314 EKRVGDYQKAS 324


>gi|291562343|emb|CBL41159.1| Ribonucleotide reductase, beta subunit [butyrate-producing
           bacterium SS3/4]
          Length = 346

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 67/137 (48%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P L+T    Q  R M+ E    EIA+ 
Sbjct: 206 MPGSAQEIRYINRDENTHLWLFRNIITELQKEQPELFTAGSVQALREMMREGVEQEIAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIG---LEPLFKYTENPFPWMSEVIDLKKEK 117
           H  +     GLN      Y++++ N R   +G   L P F+       W+S+  D    K
Sbjct: 266 HYVIGDDIPGLNRQMISDYIRYLGNLRWTSLGYPALYPGFESEPESMEWVSQYADANMVK 325

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y +   L
Sbjct: 326 TDFFEARSTAYAKSTAL 342


>gi|56419447|ref|YP_146765.1| ribonucleoside-diphosphate reductase subunit beta [Geobacillus
           kaustophilus HTA426]
 gi|56379289|dbj|BAD75197.1| ribonucleoside-diphosphate reductase beta subunit [Geobacillus
           kaustophilus HTA426]
          Length = 346

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E     R    +A  LEI +A
Sbjct: 206 MVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELADFVRNTFMKAAELEIEWA 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            E +     G++    E Y++F AN R HQ+G + P   Y  NP  W+   E +DL K  
Sbjct: 266 REIIGNDIDGIDLADLEAYIKFYANVRAHQLGFDRPFDGYRTNPLRWIKAYEEVDLGK-S 324

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 325 DFFEQKPRQYTK 336


>gi|224129040|ref|XP_002328875.1| predicted protein [Populus trichocarpa]
 gi|222839305|gb|EEE77642.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEEQVKGIVKDAVDIEREFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 241 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 299 EKRVGEYQKAS 309


>gi|317012862|gb|ADU83470.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori Lithuania75]
          Length = 341

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E ++ 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIEASWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|218197485|gb|EEC79912.1| hypothetical protein OsI_21460 [Oryza sativa Indica Group]
          Length = 345

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  + + + ++ +A  +E  + 
Sbjct: 203 MPGLTFSNELISRDEGLHCDFACLLYDLLR-------GKLDESRVQEIVADAVDIEREFV 255

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G + ++    NPF WM E+I L+ + NFF
Sbjct: 256 CDALPVALVGMNGELMSQYIEFVADRLLMALGCKKMYN-VANPFDWM-ELISLQGKTNFF 313

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 314 EKRVGDYQKAS 324


>gi|304439119|ref|ZP_07399038.1| ribonucleotide-diphosphate reductase beta subunit [Peptoniphilus
           duerdenii ATCC BAA-1640]
 gi|304372478|gb|EFM26065.1| ribonucleotide-diphosphate reductase beta subunit [Peptoniphilus
           duerdenii ATCC BAA-1640]
          Length = 347

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I  +K E P L+T+E  ++ R +L      EIA+ 
Sbjct: 207 MPGTVQEIRYINRDENTHLWLFRSIILDLKKEQPELFTEEKVEEYRALLKYGVEEEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GL +   E Y++++ N R   +G EPL++  +       W+++  D+   K
Sbjct: 267 KYVIGDDIQGLTSKMVEDYIKYLGNLRATNLGFEPLYEGYDKEVESMKWVTQYADINLLK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +VT Y + A ++ D
Sbjct: 327 TDFFEAKVTAYSKSAIIEDD 346


>gi|156102402|ref|XP_001616894.1| ribonucleoside-diphosphate reductase small chain [Plasmodium vivax
           SaI-1]
 gi|148805768|gb|EDL47167.1| ribonucleoside-diphosphate reductase small chain, putative
           [Plasmodium vivax]
          Length = 349

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 73/129 (56%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + + ++ + P       ++  + ++ EA  +E ++  E
Sbjct: 214 GLTFSNELISRDEGLHTDFNCLIYSLLENKLP-------EEVVQNIVKEAVEVERSFICE 266

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N+    QY++F+A+R    +G   +F + +NPF WM ++I L+ + NFFE 
Sbjct: 267 SLPCDLIGMNSRLMSQYIEFVADRLLECLGSPKIF-HAKNPFNWM-DLISLQGKTNFFEK 324

Query: 123 RVTEYQQGA 131
           RV +YQ+  
Sbjct: 325 RVADYQKSG 333


>gi|312130971|ref|YP_003998311.1| ribonucleoside-diphosphate reductase [Leadbetterella byssophila DSM
           17132]
 gi|311907517|gb|ADQ17958.1| Ribonucleoside-diphosphate reductase [Leadbetterella byssophila DSM
           17132]
          Length = 328

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 76/136 (55%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +  +      ++  K  +++  T++ +A  +E  + 
Sbjct: 190 MPGLTFSNELISRDEGLHRDFACLLYTK------YIVNKLPEEQVYTIIKDAVEIEKEFV 243

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NAP   QY++F+A+     + L+ ++  T NPF +M ++I L+ + NFF
Sbjct: 244 SDALPVSLIGMNAPQMCQYIEFVADHLLESLNLKKVYNAT-NPFDFM-DLISLQGKTNFF 301

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV EYQ+ AG+  D
Sbjct: 302 EKRVGEYQK-AGVTAD 316


>gi|257453171|ref|ZP_05618470.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium sp.
           3_1_5R]
 gi|317059706|ref|ZP_07924191.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 3_1_5R]
 gi|313685382|gb|EFS22217.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 3_1_5R]
          Length = 344

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     +I +IK ENP+ + +E   + R M   A   EI + 
Sbjct: 204 MVGTSDVIRLINRDELSHVVLFQKIIREIKAENPNFFQEE---EIRMMFQTAVEQEILWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+   + E Y +++AN R   IGL P++  +T+NP+  +    D + +   
Sbjct: 261 EHIIGNRVLGITTETTEAYTKWLANERLRTIGLAPMYDGFTKNPYKHLERFADTEGDGNV 320

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + +  WD
Sbjct: 321 KSNFFEGTVTSYNMSSSIDGWD 342


>gi|257467364|ref|ZP_05631675.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315918494|ref|ZP_07914734.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313692369|gb|EFS29204.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 344

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     +I +IK ENP+ + +E   + R M   A   EI + 
Sbjct: 204 MVGTSDVIRLINRDELSHVVLFQKIIREIKAENPNFFQEE---EIRMMFQTAVEQEILWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+   + E Y +++AN R   IGL P++  +T+NP+  +    D + +   
Sbjct: 261 EHIIGNRVLGITTETTEAYTKWLANERLRTIGLAPMYDGFTKNPYKHLERFADTEGDGNV 320

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + +  WD
Sbjct: 321 KSNFFEGTVTSYNMSSSIDGWD 342


>gi|291244313|ref|XP_002742041.1| PREDICTED: ribonucleotide reductase M2 polypeptide-like
           [Saccoglossus kowalevskii]
          Length = 463

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 9/128 (7%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + +       HL  K  +++ R ++ +A  +E  + +E
Sbjct: 327 GLTFSNELISRDEGLHCDFACLIFS-------HLTYKPSKERIRNIITQAVDIEKEFWNE 379

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P G +G+N      Y++F+A+R   ++  + ++ + ENPF +M E I L+ + NFFE 
Sbjct: 380 ALPVGLIGMNVTLMNYYVEFVADRLLLELNCDKVY-HRENPFDFM-ENISLEGKTNFFEK 437

Query: 123 RVTEYQQG 130
           RV EYQ+ 
Sbjct: 438 RVGEYQKA 445


>gi|255079598|ref|XP_002503379.1| predicted protein [Micromonas sp. RCC299]
 gi|226518645|gb|ACO64637.1| predicted protein [Micromonas sp. RCC299]
          Length = 335

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + I         K  +   R ++ EA  +E  + 
Sbjct: 196 MPGLTFSNELISRDEGLHRDFACLLYSYIN-------KKPNESVVRQIVKEAVEIEKEFV 248

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+NA    +Y++F+A+    Q+G+   +    NPF WM E+I L+ + NFF
Sbjct: 249 CDALPCALVGMNADLMSEYIEFVADHLLGQLGMSKEYN-AANPFDWM-ELISLQGKTNFF 306

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 307 EKRVGEYQKSG 317


>gi|289620013|emb|CBI53457.1| unnamed protein product [Sordaria macrospora]
          Length = 410

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQLIQDIIVDAVRIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA   +QY++F+A+R    +G E +++ T NPF +M E I L  + NFF
Sbjct: 313 TEALPCALLGMNADLMKQYIEFVADRLLVALGNEKVYRST-NPFDFM-ENISLGGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVADYQKAG 381


>gi|145349720|ref|XP_001419276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144579507|gb|ABO97569.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 329

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +         K  ++  R ++ EA  +E  + 
Sbjct: 189 MPGLTFSNELISRDEGLHRDFACLLFSMLN-------NKPSEETIRKIVTEAVEIEKEFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   VG+NA     Y++++A+     +GL   +  T NPF WM E+I L+ + NFF
Sbjct: 242 CDSLPCALVGMNAGMMSDYIEYVADHLFCSLGLAKEYN-TTNPFDWM-ELISLQGKTNFF 299

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 300 EKRVGEYQKAG 310


>gi|19881429|ref|NP_612246.1| putative ribonucleotide reductase small subunit [Infectious spleen
           and kidney necrosis virus]
 gi|19773634|gb|AAL98748.1|AF371960_24 putative ribonucleotide reductase small subunit [infectious spleen
           and kidney necrosis virus]
          Length = 312

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   +  Q+         K  Q  +  ++ +A  +E A+ 
Sbjct: 176 MPGLAFSNELISRDEGLHCDFACMLFRQMA-------NKPCQDDAHQIISDAVDIETAFF 228

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S   Y+QF+A+R    +G   ++    NPF +M   I ++ + NFF
Sbjct: 229 QEALKTPLLGMNSDSMRLYIQFVADRLLDALGYAKMYN-VANPFDFMDN-ISIEGKTNFF 286

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 287 ERRVSEYQR 295


>gi|1710399|sp|P50649|RIR2_PLAFG RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase R2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|349790|gb|AAA29754.1| ribonucleotide reductase R2 subunit [Plasmodium falciparum]
          Length = 322

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 74/131 (56%), Gaps = 11/131 (8%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI--AYA 60
           G+    + I RDE LH +F   + + +  + P       +Q  + ++ EA  +E+  ++ 
Sbjct: 185 GLTFSNELISRDEGLHTDFNCLIYSLLDNKLP-------EQMVQNIVKEAGGVEVEKSFI 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+A+R    +G   +F +++NPF WM ++I L+ + NFF
Sbjct: 238 CESLPCDLIGMNSRLMSQYIEFVADRLLECLGCSKIF-HSKNPFNWM-DLISLQGKTNFF 295

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 296 EKRVADYQKSG 306


>gi|269105083|ref|ZP_06157778.1| ribonucleotide reductase 2 [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268160718|gb|EEZ39216.1| ribonucleotide reductase 2 [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 310

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 14/132 (10%)

Query: 1   MVGIAEQYQYIMRDESLHLNFG---IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 57
           + G+A     I RDE LH +F       + Q K+          QQ+   +  EA  +E 
Sbjct: 178 LAGLAASNDLIARDEGLHFSFSALLFKTLGQGKVT---------QQEFEEICREAVSIEK 228

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P   +G+NA    QY++  A+      G +P+F Y +NPF +M  ++D++ + 
Sbjct: 229 EFVTEALPVDLIGMNAELMCQYIEHTADVIAGLFGFDPIF-YAKNPFDYM-RLLDMEGKT 286

Query: 118 NFFETRVTEYQQ 129
           NFFE RVTEY++
Sbjct: 287 NFFEKRVTEYKR 298


>gi|256421019|ref|YP_003121672.1| ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
 gi|256035927|gb|ACU59471.1| Ribonucleoside-diphosphate reductase [Chitinophaga pinensis DSM
           2588]
          Length = 323

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F   +   ++   P       +++  T++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCEFACLLYGMLENRLP-------EEQVHTIIRDAVAIEKEFI 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++F+A+R   ++G   +F  T NPF +M E+I L+ + NFF
Sbjct: 239 TDALPVALIGMNSKLMSEYIEFVADRWLSELGYTKIFN-TANPFDFM-EMISLQGKTNFF 296

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 297 EKRVGDYQKAG 307


>gi|158286793|ref|XP_308927.4| AGAP006818-PA [Anopheles gambiae str. PEST]
 gi|157020637|gb|EAA04227.4| AGAP006818-PA [Anopheles gambiae str. PEST]
          Length = 400

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++   ++ +A L+E  + 
Sbjct: 263 MPGLTFSNELISRDEGLHCDFACLMFK-------YLVQKPSKERVTEIIRDAVLIEQEFL 315

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G E ++ +T+NPF +M E I L+ + NFF
Sbjct: 316 TKALPVDMLGMNCDLMSQYIEFVADRLLLELGCEKIY-HTKNPFSFM-EFISLEGKTNFF 373

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 374 EKKVGEYQK 382


>gi|260061082|ref|YP_003194162.1| putative ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
 gi|88785214|gb|EAR16383.1| probable ribonucleoside-diphosphate reductase small chain
           [Robiginitalea biformata HTCC2501]
          Length = 328

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 72/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H ++ +       + N HL  K  +++   ++  A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDYAV------HLHNNHLVNKVPKERITQIITNALDIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+NA    QY++F+ +R   ++  E ++  T NPF +M ++I L+ + NFF
Sbjct: 241 TESLPVSLIGMNAKLMTQYLEFVTDRLLVELECEKVYNST-NPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+  
Sbjct: 299 EKRVSEYQKAG 309


>gi|221120499|ref|XP_002159812.1| PREDICTED: similar to hCG23833 [Hydra magnipapillata]
          Length = 387

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F         +   H+  K  +++ + ++ +A  +EI +  E
Sbjct: 245 GVTFSNELISRDEGLHCDFAC-------LMYKHIVNKPSEERVKQIIRDAVAIEIEFLTE 297

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+N    + Y++F A+R  + +G    +   ENPF +M E I L ++ NFFE+
Sbjct: 298 SLPCDLLGMNKSLMKTYIEFCADRLINALGYSKEWN-VENPFDFM-ENISLARKANFFES 355

Query: 123 RVTEYQQGA 131
           RV++YQ+  
Sbjct: 356 RVSDYQKAG 364


>gi|18859327|ref|NP_571525.1| ribonucleoside-diphosphate reductase subunit M2 [Danio rerio]
 gi|292624782|ref|XP_002665783.1| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Danio rerio]
 gi|3914657|sp|P79733|RIR2_DANRE RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase protein R2 class
           I; AltName: Full=Ribonucleotide reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|1695831|gb|AAB37103.1| ribonucleotide reductase protein R2 class I [Danio rerio]
 gi|27881838|gb|AAH44355.1| Ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|56207929|emb|CAI21240.1| ribonucleotide reductase M2 polypeptide [Danio rerio]
 gi|182889152|gb|AAI64707.1| Rrm2 protein [Danio rerio]
          Length = 386

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  ++  + ++  A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HLINKPSEETVKKIIMNAVEIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    +QY++F+A+R   ++G + +++  ENPF +M E I L+ + NFF
Sbjct: 302 TDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYR-VENPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 360 EKRVGEYQR 368


>gi|156058956|ref|XP_001595401.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980]
 gi|154701277|gb|EDO01016.1| hypothetical protein SS1G_03490 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 407

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ EA  +E  + 
Sbjct: 254 MAGLTFSNELISRDEGLHTDFACLLFS-------HLKHRPSKQAVQDVITEAVEIEQEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G + ++K + NPF +M E I L  + NFF
Sbjct: 307 TEALPCALLGMNSTLMKQYIEFVADRLLVTLGNDKVYK-SANPFDFM-ENISLAGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 365 EKRVGDYQKAG 375


>gi|91081999|ref|XP_969259.1| PREDICTED: similar to AGAP006818-PA [Tribolium castaneum]
 gi|270007377|gb|EFA03825.1| hypothetical protein TcasGA2_TC013940 [Tribolium castaneum]
          Length = 374

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  +++ ++++ +A  +E  + 
Sbjct: 238 MPGLTFSNELISRDEGLHCDFACLMFS-------HLVQKPSKERIQSIIQDAVKIEKEFL 290

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G E ++  ++NPF +M+ +I  + + NFF
Sbjct: 291 TEALPVSMIGMNCALMCQYIEFVADRLLGELGCEKIYN-SQNPFDFMT-IISNEGKTNFF 348

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 349 EKKVGEYQKSG 359


>gi|17551968|ref|NP_497821.1| RiboNucleotide Reductase family member (rnr-2) [Caenorhabditis
           elegans]
 gi|1172941|sp|P42170|RIR2_CAEEL RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|3873950|emb|CAA84688.1| C. elegans protein C03C10.3, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 381

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + ++++        K  QQ+   ++ +A  +E  + 
Sbjct: 244 MPGLTHSNELISRDEGLHRDFACLLYSKLQ-------KKLTQQRIYDIIKDAVAIEQEFL 296

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+    ++G + L+K ++NPF +M E I +  + NFF
Sbjct: 297 TEALPVDMIGMNCRLMSQYIEFVADHLLVELGCDKLYK-SKNPFDFM-ENISIDGKTNFF 354

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 355 EKRVSEYQR 363


>gi|50237508|gb|AAT71841.1| ribonucleotide reductase small chain [Rock bream iridovirus]
          Length = 312

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   +  Q+         K  Q  +  ++ +A  +E A+ 
Sbjct: 176 MPGLAFSNELISRDEGLHCDFACMLFRQMA-------NKPCQDDAHEIISDAVDIETAFF 228

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S + Y+QF+A+R    +G   ++    NPF +M   I ++ + NFF
Sbjct: 229 REALKTPLLGMNSDSMKLYIQFVADRLLDALGYAKMYN-VGNPFDFMDN-ISIEGKTNFF 286

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 287 ERRVSEYQR 295


>gi|62421216|gb|AAX82336.1| ribonucleotide reductase small chain [Orange-spotted grouper
           iridovirus]
          Length = 312

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   +  Q+         K  Q  +  ++ +A  +E A+ 
Sbjct: 176 MPGLAFSNELISRDEGLHCDFACMLFRQMA-------NKPCQDDAHEIISDAVDIETAFF 228

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S + Y+QF+A+R    +G   ++    NPF +M   I ++ + NFF
Sbjct: 229 REALKTPLLGMNSDSMKLYIQFVADRLLDALGYAKMYN-VGNPFDFMDN-ISIEGKTNFF 286

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 287 ERRVSEYQR 295


>gi|148230557|ref|NP_001080772.1| ribonucleotide reductase M2 polypeptide [Xenopus laevis]
 gi|28839018|gb|AAH47975.1| Rrm2-prov protein [Xenopus laevis]
          Length = 386

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++   ++  A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFR-------HLVHKPSEERVVQLITNAVQIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +FK + NPF +M E I L+ + NFF
Sbjct: 302 TEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKAS-NPFDFM-ENISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 360 EKRVGEYQK 368


>gi|319953269|ref|YP_004164536.1| ribonucleoside-diphosphate reductase [Cellulophaga algicola DSM
           14237]
 gi|319421929|gb|ADV49038.1| Ribonucleoside-diphosphate reductase [Cellulophaga algicola DSM
           14237]
          Length = 326

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 75/136 (55%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N H+  +  +++   +L +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGMHCDFAV------HLHNKHIINQVPKERITEILVDALNIEREFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+ +R   ++  + ++  T NPF +M ++I ++ + NFF
Sbjct: 240 TESLPASLIGMNSKLMTQYLEFVTDRLLVELECDKVYNST-NPFDFM-DMIGMEGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   L  D
Sbjct: 298 EKRVSEYQKAGVLNSD 313


>gi|237749822|ref|ZP_04580302.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           bilis ATCC 43879]
 gi|229374572|gb|EEO24963.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           bilis ATCC 43879]
          Length = 351

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M   AE  ++I RDE  HL     +I   + E P L+T+  Q +   M  +A  LE ++ 
Sbjct: 214 MQNSAEMIRFIQRDEITHLTIFQQMIISTRKERPDLFTQALQDEVMEMFRQAVDLESSWG 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL A    QY++++A++R   +   P+   T+NP  W+ E ++   ++ NF
Sbjct: 274 EYITQGQILGLTAKIIRQYIEYLADKRLKAVDY-PILYNTQNPIQWVDEQVNFNNQRTNF 332

Query: 120 FETRVTEYQQG 130
           FE +V  Y +G
Sbjct: 333 FEAKVRNYTRG 343


>gi|167462363|ref|ZP_02327452.1| ribonucleoside-diphosphate reductase beta subunit [Paenibacillus
           larvae subsp. larvae BRL-230010]
          Length = 343

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 71/130 (54%), Gaps = 4/130 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G     ++I RDE +H+     +  ++  ENP L  +E  +  R    +A  LEIA++
Sbjct: 203 MLGTNTMIRFINRDEEIHVRLFTQIFRELIAENPELDNEETHEFVRQTFRKAAELEIAWS 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
              +   F G+ +   ++Y++F+AN+R +++G+E P   +  N   W+   E  D  K  
Sbjct: 263 EYIIGDRFDGVTSRDLDKYVRFMANKRVNELGIERPFEGHRRNNLRWIKAYEENDAGK-T 321

Query: 118 NFFETRVTEY 127
           +FFE+RVT+Y
Sbjct: 322 DFFESRVTQY 331


>gi|171687074|ref|XP_001908478.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943498|emb|CAP69151.1| unnamed protein product [Podospora anserina S mat+]
          Length = 409

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q    ++ +A  +E  + 
Sbjct: 259 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQLVEDIIRDAVTIEQEFL 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G + +++ T NPF +M E I L  + NFF
Sbjct: 312 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNDKIYRST-NPFDFM-ENISLGGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 370 EKRVGEYQKAG 380


>gi|12085003|ref|NP_073405.1| 20L protein [Yaba-like disease virus]
 gi|56404692|sp|Q9DHU2|RIR2_YLDV RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|12056179|emb|CAC21258.1| 20L protein [Yaba-like disease virus]
          Length = 325

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         I   HL         R ++ EA  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFAC-------IMFKHLLNPPLNSVVRDIIIEAVNIEKNFL 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G +  +  ++NPF +M E I L+ + NFF
Sbjct: 241 TEAIPVKLIGMNCDLMKQYIEFVADRLLLELGCDKYY-CSKNPFDFM-ENISLEGKTNFF 298

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 299 EKRVSEYQK 307


>gi|297530897|ref|YP_003672172.1| ribonucleotide reductase [Geobacillus sp. C56-T3]
 gi|297254149|gb|ADI27595.1| ribonucleotide reductase [Geobacillus sp. C56-T3]
          Length = 346

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E     R    +A  LEI +A
Sbjct: 206 MVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELSDFVRETFTKAAELEIEWA 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            E +     G++    E Y++F AN R HQ+G + P   Y  NP  W+   E +DL K  
Sbjct: 266 GEIIGNDIDGIDLADLEAYIKFYANVRAHQLGFDRPFDGYRTNPLRWIKAYEEVDLGK-S 324

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 325 DFFEQKPRQYTK 336


>gi|261839822|gb|ACX99587.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori 52]
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|261419130|ref|YP_003252812.1| ribonucleoside-diphosphate reductase [Geobacillus sp. Y412MC61]
 gi|319765947|ref|YP_004131448.1| ribonucleotide reductase [Geobacillus sp. Y412MC52]
 gi|261375587|gb|ACX78330.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. Y412MC61]
 gi|317110813|gb|ADU93305.1| ribonucleotide reductase [Geobacillus sp. Y412MC52]
          Length = 346

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E     R    +A  LEI +A
Sbjct: 206 MVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYRTPELSDFVRETFTKAAELEIEWA 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            E +     G++    E Y++F AN R HQ+G + P   Y  NP  W+   E +DL K  
Sbjct: 266 GEIIGNDIDGIDLADLEAYIKFYANVRAHQLGFDRPFDGYRTNPLRWIKAYEEVDLGK-S 324

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 325 DFFEQKPRQYTK 336


>gi|298207002|ref|YP_003715181.1| probable ribonucleoside-diphosphate reductase small chain
           [Croceibacter atlanticus HTCC2559]
 gi|83849636|gb|EAP87504.1| probable ribonucleoside-diphosphate reductase small chain
           [Croceibacter atlanticus HTCC2559]
          Length = 325

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 74/136 (54%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++ R ++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGMHCDFAV------HLHNKHLVNKVSKERIREIIVDALNIEREFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+ +R   ++  E  +  T NPF +M ++I L+ + NFF
Sbjct: 240 TESLPASLIGMNSNLMTQYLEFVTDRLLLELECEKEYN-TANPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV +YQ+   +  D
Sbjct: 298 EKRVGDYQKAGVMDQD 313


>gi|67585619|ref|XP_665115.1| ribonucleotide reductase R2 subunit [Cryptosporidium hominis TU502]
 gi|54655552|gb|EAL34885.1| ribonucleotide reductase R2 subunit [Cryptosporidium hominis]
          Length = 296

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K + P         + + ++ EA  +E  + 
Sbjct: 159 MPGLTFSNELISRDEGLHADFACLIYKALKFKLP-------APRVQQIISEAVEVERNFL 211

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R    + +  ++  + NPF WM ++I L+ + NFF
Sbjct: 212 CDSLPVDLIGMNSRLMAQYIEFVADRLLFALDIPKIYNVS-NPFDWM-DLISLQGKTNFF 269

Query: 121 ETRVTEYQQGA 131
           E RV EYQ   
Sbjct: 270 EKRVGEYQMAG 280


>gi|85109237|ref|XP_962820.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
 gi|30316285|sp|Q9C167|RIR2_NEUCR RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|16273691|gb|AAK14804.2| small subunit of ribonucleotide reductase [Neurospora crassa]
 gi|28924456|gb|EAA33584.1| ribonucleoside-diphosphate reductase M2 subunit [Neurospora crassa
           OR74A]
          Length = 410

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQLIQEIIVDAVRIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA   +QY++F+A+R    +G E +++ T NPF +M E I L  + NFF
Sbjct: 313 TEALPCALLGMNADLMKQYIEFVADRLLVALGNEKIYRST-NPFDFM-ENISLGGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|325286576|ref|YP_004262366.1| Ribonucleoside-diphosphate reductase [Cellulophaga lytica DSM 7489]
 gi|324322030|gb|ADY29495.1| Ribonucleoside-diphosphate reductase [Cellulophaga lytica DSM 7489]
          Length = 328

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 72/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H ++ +       + N HL  K  +++   +L +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDYAV------HLHNHHLINKVPKERITEILVDALDIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+ +R   ++  + ++  T NPF +M ++I L+ + NFF
Sbjct: 241 TESLPVSLIGMNSKLMTQYLEFVTDRLLVELNCDKVYNST-NPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 299 EKRVAEYQKSG 309


>gi|195119943|ref|XP_002004488.1| GI19586 [Drosophila mojavensis]
 gi|193909556|gb|EDW08423.1| GI19586 [Drosophila mojavensis]
          Length = 393

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVMMFR-------HLVQRPSRERIIEIISDAVTIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCALMSQYIEFVADRLLVELGVGKIYN-TKNPFTFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVGEYQR 375


>gi|108563454|ref|YP_627770.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori HPAG1]
 gi|107837227|gb|ABF85096.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori HPAG1]
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|283955349|ref|ZP_06372848.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 414]
 gi|283793109|gb|EFC31879.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 414]
          Length = 340

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+  E   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLSAINLDKLYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|15644992|ref|NP_207162.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori 26695]
 gi|2500210|sp|P55983|RIR2_HELPY RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2313466|gb|AAD07432.1| ribonucleoside diphosphate reductase, beta subunit (nrdB)
           [Helicobacter pylori 26695]
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|188996383|ref|YP_001930634.1| Ribonucleoside-diphosphate reductase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931450|gb|ACD66080.1| Ribonucleoside-diphosphate reductase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 326

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 3/129 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK-EFQQKSRTMLHEATLLEIAY 59
           M  +    + I+ DESLHL  GI+ I  +  ENP +    +F +  R  + +A  LE+ Y
Sbjct: 196 MKNVVSGVELILIDESLHLQNGIEAILTMVEENPEIVDDYQFVENIRQSIIDAVELELNY 255

Query: 60  AHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
                    + G++    E+YM++IA+RR  ++G +P F   +NP  ++ +  D+KK  N
Sbjct: 256 LKTKFGGTTIFGVSYGELERYMKYIADRRLIELGFDPQFGIDQNPLKFLQKE-DVKKLTN 314

Query: 119 FFETRVTEY 127
           FFE   TEY
Sbjct: 315 FFEVSSTEY 323


>gi|86149605|ref|ZP_01067835.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|86151167|ref|ZP_01069382.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|86153704|ref|ZP_01071907.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|88597173|ref|ZP_01100408.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 84-25]
 gi|121613260|ref|YP_999944.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. jejuni 81-176]
 gi|157414529|ref|YP_001481785.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|167004901|ref|ZP_02270659.1| ribonucleoside-diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni 81-176]
 gi|218561895|ref|YP_002343674.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|283955655|ref|ZP_06373148.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|315123818|ref|YP_004065822.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           jejuni subsp. jejuni ICDCCJ07001]
 gi|85839873|gb|EAQ57132.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni CF93-6]
 gi|85841514|gb|EAQ58761.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 260.94]
 gi|85842665|gb|EAQ59877.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni HB93-13]
 gi|87250215|gb|EAQ73173.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 81-176]
 gi|88190234|gb|EAQ94208.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 84-25]
 gi|112359601|emb|CAL34386.1| ribonucleoside-diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|157385493|gb|ABV51808.1| ribonucleoside-diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|283792880|gb|EFC31656.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|284925507|gb|ADC27859.1| ribonucleoside-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. jejuni IA3902]
 gi|307747171|gb|ADN90441.1| Ribonucleoside-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. jejuni M1]
 gi|315017540|gb|ADT65633.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           jejuni subsp. jejuni ICDCCJ07001]
 gi|315928159|gb|EFV07477.1| ribonucleotide reductase, small chain family protein [Campylobacter
           jejuni subsp. jejuni DFVF1099]
 gi|315932030|gb|EFV10983.1| ribonucleotide reductase, small chain family protein [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 340

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+  E   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLSAINLDKLYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|207092116|ref|ZP_03239903.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori HPKX_438_AG0C1]
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|205356539|ref|ZP_03223302.1| ribonucleoside diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|205345544|gb|EDZ32184.1| ribonucleoside diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 340

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+  E   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLSAINLDKLYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|57237291|ref|YP_178304.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           jejuni RM1221]
 gi|148926379|ref|ZP_01810063.1| ribonucleoside-diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|57166095|gb|AAW34874.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni RM1221]
 gi|145844771|gb|EDK21876.1| ribonucleoside-diphosphate reductase beta chain [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|315057661|gb|ADT71990.1| Ribonucleotide reductase of class Ia (aerobic), beta subunit
           [Campylobacter jejuni subsp. jejuni S3]
          Length = 340

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+  E   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLSAINLDKLYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|317182342|dbj|BAJ60126.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F57]
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|38229183|ref|NP_938276.1| 20L [Yaba monkey tumor virus]
 gi|38000454|gb|AAR07377.1| 20L [Yaba monkey tumor virus]
          Length = 325

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +   NP L     +   R ++ EA  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACMMFKHLS--NPPL-----ENVIRDIVIEAVDIEKNFL 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E MP   +G+N    +QY++F+A+R   ++G +  +  ++NPF +M E I L+ + NFF
Sbjct: 241 TEAMPVKLIGMNCDLMKQYIEFVADRLLLELGCKKYY-CSKNPFDFM-ENISLEGKTNFF 298

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 299 EKRVSEYQK 307


>gi|86132508|ref|ZP_01051102.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
 gi|85817069|gb|EAQ38253.1| ribonucleoside-diphosphate reductase small chain [Dokdonia
           donghaensis MED134]
          Length = 328

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F +       + N HL  K  +++   ++  A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGVHCDFAV------HLHNHHLVNKVPKERITEIIVNALDIEREFI 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++++ +R   ++  E ++  T NPF +M ++I L+ + NFF
Sbjct: 240 TESLPVSLIGMNSNLMTQYLEYVTDRLLTELDCEKVYN-TANPFDFM-DMISLQGKTNFF 297

Query: 121 ETRVTEYQQGAGLK 134
           E RV EYQ+   +K
Sbjct: 298 EKRVGEYQKAGVVK 311


>gi|62637405|ref|YP_227403.1| Ribonucleotide reductase small subunit [Deerpox virus W-848-83]
 gi|115503265|gb|ABI99183.1| ribonucleotide reductase small subunit [Deerpox virus W-848-83]
          Length = 321

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +  Q+ +  P         +   ++ EA  +E ++ 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLMFKQL-LYPPS------TSRIINIIVEAVSIEKSFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G   +FK +ENPF +M E I L+ + NFF
Sbjct: 237 TKALPVKLIGMNCELMCQYIEFVADRLLSELGCNKIFK-SENPFDFM-ESISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV++YQ+
Sbjct: 295 EKRVSDYQK 303


>gi|72008642|ref|XP_780110.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           isoform 1 [Strongylocentrotus purpuratus]
 gi|115928579|ref|XP_001179668.1| PREDICTED: similar to ribonucleotide reductase protein R2 class I
           [Strongylocentrotus purpuratus]
          Length = 412

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  ++  + ++ EA  +E  + 
Sbjct: 270 MPGLTFSNELISRDEGLHCDFACLMFK-------HLNNKPDEEHVQGIIKEAVAIEQEFL 322

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA   ++Y++F+A+R   ++G   ++K  ENPF +M E I L+ + NFF
Sbjct: 323 TDALPCSLIGMNAVLMKRYIEFVADRLLVELGCGKIWK-VENPFDFM-ENISLEGKTNFF 380

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 381 EKRVGEYQK 389


>gi|301097698|ref|XP_002897943.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
 gi|262106388|gb|EEY64440.1| ribonucleoside-diphosphate reductase small chain [Phytophthora
           infestans T30-4]
          Length = 360

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 76/135 (56%), Gaps = 10/135 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE +H +F   + +++  + P       + +   ++ +A  +E  + 
Sbjct: 223 MPGLSFSNEMISRDEGMHTDFACLMYSKLVNKLP-------ESRVHEIIRDAVAIEHEFV 275

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R  + +G+  ++   +NPF WM ++I L+ + NFF
Sbjct: 276 CDSLPVELIGMNSALMCQYIEFVADRLLYSLGVSKIYN-VKNPFDWM-DMISLQGKTNFF 333

Query: 121 ETRVTEYQQ-GAGLK 134
           E RV EY + G G+ 
Sbjct: 334 EKRVGEYSKAGVGVS 348


>gi|332185556|ref|ZP_08387304.1| ribonucleotide reductase, small chain family protein [Sphingomonas
           sp. S17]
 gi|332014534|gb|EGI56591.1| ribonucleotide reductase, small chain family protein [Sphingomonas
           sp. S17]
          Length = 351

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + +    E   L TK  +            LE  + 
Sbjct: 178 MKGMGQIVTWSVRDESLHCEGIIQLFHAFTKERQCL-TKAVKDDIADQCQTTVRLEDNFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+ A   ++Y+++IA+ R  Q+GL+P++   E+P PW++ +++  +  NF
Sbjct: 237 DLAFEMGPVNGMTAKDIKKYIRYIADWRLGQLGLKPIYMIDEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|323143005|ref|ZP_08077711.1| ribonucleoside-diphosphate reductase, beta subunit [Succinatimonas
           hippei YIT 12066]
 gi|322417199|gb|EFY07827.1| ribonucleoside-diphosphate reductase, beta subunit [Succinatimonas
           hippei YIT 12066]
          Length = 331

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 70/136 (51%), Gaps = 10/136 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH-----EATLL 55
           M G+ +   + + DE+LH    I +  +   +NP LW  + +    ++       E + +
Sbjct: 188 MRGMGQIIAWSINDETLHTESMIKLFREYIEQNPQLWNDDLKSTIYSIAEKMVELEDSFI 247

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           ++A+    M K    L     ++Y++FIA+RR   +G++ +F   +NP PW+  ++ +  
Sbjct: 248 DLAFGVNQMQK----LAKEDVKKYIRFIADRRLSAMGMKAIFNEKKNPLPWVDAMLGV-T 302

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE RV +Y +GA
Sbjct: 303 HTNFFENRVVDYAKGA 318


>gi|317009697|gb|ADU80277.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori India7]
          Length = 341

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|208434985|ref|YP_002266651.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori G27]
 gi|208432914|gb|ACI27785.1| ribonucleoside diphosphate reductase, beta subunit [Helicobacter
           pylori G27]
          Length = 341

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|302783485|ref|XP_002973515.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
 gi|302787555|ref|XP_002975547.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300156548|gb|EFJ23176.1| hypothetical protein SELMODRAFT_175019 [Selaginella moellendorffii]
 gi|300158553|gb|EFJ25175.1| hypothetical protein SELMODRAFT_173451 [Selaginella moellendorffii]
          Length = 347

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + + +       K  +++ + ++ +A  +E  + 
Sbjct: 205 MPGLTFSNELISRDEGLHCDFACLLYSLLNV-------KLDEKRVKEIVSDAVEIERQFV 257

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    VG+NA    QY+ F+A+R    +G   LF    NPF WM ++I L+ + NFF
Sbjct: 258 CEALSCDLVGMNARLMSQYIDFVADRLMVVLGYNKLFNAI-NPFDWM-DLISLQGKTNFF 315

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 316 EKRVGEYQKAS 326


>gi|294877483|ref|XP_002768004.1| ribonucleotide reductase R2 subunit, putative [Perkinsus marinus
           ATCC 50983]
 gi|239870142|gb|EER00722.1| ribonucleotide reductase R2 subunit, putative [Perkinsus marinus
           ATCC 50983]
          Length = 247

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 69/124 (55%), Gaps = 8/124 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +FG  + N +K      +T+  +++   ++  A  +E  + 
Sbjct: 108 MPGLTFSNELISRDEGLHTDFGCLLYNMLK------FTRLPEERVEDIVRSAVNVEREFI 161

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P G +G+NA    +Y++F+A+R    +G   ++  + NPF WM+ +I L+ + NFF
Sbjct: 162 TDALPVGLIGMNAELMGRYIEFVADRLLVALGYAKIYN-SANPFDWMT-MISLQGKTNFF 219

Query: 121 ETRV 124
           E RV
Sbjct: 220 EKRV 223


>gi|114568952|ref|YP_755632.1| ribonucleotide-diphosphate reductase subunit beta [Maricaulis maris
           MCS10]
 gi|114339414|gb|ABI64694.1| Ribonucleoside-diphosphate reductase [Maricaulis maris MCS10]
          Length = 345

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + +    E   L T+E +            LE  + 
Sbjct: 186 MKGMGQIVTWSIRDESLHCEGMIKLFHAFAEETGAL-TQEVKDDITECCRTVVGLEDKFI 244

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     + Y+++IA+ R  Q+GL  ++   E+P PW+SE+++  +  NF
Sbjct: 245 DLAFEAGDVEGMTPDDIKTYIRYIADWRLGQLGLPKIYGVKEHPLPWLSEILNGVEHANF 304

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 305 FEARATEYSKGA 316


>gi|294013210|ref|YP_003546670.1| ribonucleoside-diphosphate reductase beta chain [Sphingobium
           japonicum UT26S]
 gi|292676540|dbj|BAI98058.1| ribonucleoside-diphosphate reductase beta chain [Sphingobium
           japonicum UT26S]
          Length = 351

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  +    ++     T   +     M  +   +E A+ 
Sbjct: 178 MKGMGQIVSWSVRDETLHCE-GIVRLFHAFVKERDCLTASVKDDIMDMCQKTVRIEDAFV 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL+P++   E+P PW++ +++  +  NF
Sbjct: 237 DLVFEMGPVPGMTPKDIKKYVRYIADWRLGQLGLKPIYMIDEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|211956300|ref|YP_002302368.1| ribonucleotide reductase small subunit [Deerpox virus W-1170-84]
 gi|115503095|gb|ABI99013.1| ribonucleotide reductase small subunit [Deerpox virus W-1170-84]
          Length = 321

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +  Q+ +  P+        +   ++ EA  +E ++ 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLMFKQL-LHPPN------PSRIINIIVEAVSIEKSFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R   ++G   +FK +ENPF +M E I L+ + NFF
Sbjct: 237 TTALPVKLIGMNCELMCQYIEFVADRLLSELGCTKIFK-SENPFDFM-ESISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV++YQ+
Sbjct: 295 EKRVSDYQK 303


>gi|217032591|ref|ZP_03438080.1| hypothetical protein HPB128_159g17 [Helicobacter pylori B128]
 gi|298735909|ref|YP_003728434.1| ribonucleoside-diphosphate reductase subunit beta [Helicobacter
           pylori B8]
 gi|216945727|gb|EEC24352.1| hypothetical protein HPB128_159g17 [Helicobacter pylori B128]
 gi|298355098|emb|CBI65970.1| ribonucleoside-diphosphate reductase beta chain [Helicobacter
           pylori B8]
          Length = 341

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPKLINEVIEMFKKAVEIEALWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|66475262|ref|XP_627447.1| ribonucleotide reductase small subunit, duplicated adjacent gene
           [Cryptosporidium parvum Iowa II]
 gi|9652154|gb|AAF91416.1|AF275635_1 ribonucleotide reductase R2 subunit [Cryptosporidium parvum]
 gi|46228920|gb|EAK89769.1| ribonucleotide reductase small subunit, duplicated adjacent gene
           [Cryptosporidium parvum Iowa II]
          Length = 352

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K + P         + + ++ EA  +E  + 
Sbjct: 215 MPGLTFSNELISRDEGLHADFACLIYKALKFKLP-------APRVQQIISEAVEVERNFL 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    QY++F+A+R    + +  ++  + NPF WM ++I L+ + NFF
Sbjct: 268 CDSLPVDLIGMNSRLMAQYIEFVADRLLFALDIPKIYNVS-NPFDWM-DLISLQGKTNFF 325

Query: 121 ETRVTEYQQGA 131
           E RV EYQ   
Sbjct: 326 EKRVGEYQMAG 336


>gi|323450429|gb|EGB06310.1| hypothetical protein AURANDRAFT_65685 [Aureococcus anophagefferens]
          Length = 349

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 73/134 (54%), Gaps = 10/134 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE +H +F   + ++++ + P        +    ++ +A  +E  + 
Sbjct: 212 MPGLSFSNELISRDEGMHCDFACLLYSKLRNKLP-------VETINALIGDAVTIEKEFV 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N+ +  QY++F A+R    +G   L++ T NPF WM E+I L+ + NFF
Sbjct: 265 VSALPVELIGMNSRTMCQYIEFCADRLLLALGCPKLYEAT-NPFDWM-ELISLQGKTNFF 322

Query: 121 ETRVTEY-QQGAGL 133
           E RV EY + G G+
Sbjct: 323 EKRVGEYAKSGVGV 336


>gi|145537171|ref|XP_001454302.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124422057|emb|CAK86905.1| unnamed protein product [Paramecium tetraurelia]
          Length = 507

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K   Q+   ++  A  +E  + 
Sbjct: 370 MPGLTFSNELISRDEGLHTDFAC-------LLYKHMINKLSIQRVHEIISSAVEIEKEFI 422

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G   ++  ++NPF WM ++I L+ + NFF
Sbjct: 423 SEALPVELIGMNSNLMKQYIEFVADRLIFALGAPKIYN-SKNPFEWM-DMISLQGKTNFF 480

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 481 ERRVGDYQKAG 491


>gi|294501621|ref|YP_003565321.1| ribonucleoside-diphosphate reductase subunit beta [Bacillus
           megaterium QM B1551]
 gi|295706969|ref|YP_003600044.1| ribonucleoside-diphosphate reductase subunit beta [Bacillus
           megaterium DSM 319]
 gi|294351558|gb|ADE71887.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus
           megaterium QM B1551]
 gi|294804628|gb|ADF41694.1| ribonucleoside-diphosphate reductase, beta subunit [Bacillus
           megaterium DSM 319]
          Length = 347

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 14/140 (10%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE LH+     +  ++  ENP   T+E +        EA  LEI +A
Sbjct: 205 MVATSTMINYINRDEQLHVGLFEKIFKEVLNENPAYRTEELETFVVETFQEAARLEIEWA 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGL-------EPLFKYTENPFPWM--SEVI 111
              + + F G+     +QY++++AN+RC+Q+G         P+    ENP  W+   + +
Sbjct: 265 ESVIGEKFDGITMKELQQYIEYMANKRCNQLGFGRAAFPEAPI----ENPLRWIIAYQEV 320

Query: 112 DLKKEKNFFETRVTEYQQGA 131
           DL K  +FFE +  +Y + +
Sbjct: 321 DLGK-TDFFEQKSRQYTKAS 339


>gi|195333568|ref|XP_002033462.1| GM20395 [Drosophila sechellia]
 gi|195582581|ref|XP_002081105.1| GD25870 [Drosophila simulans]
 gi|194125432|gb|EDW47475.1| GM20395 [Drosophila sechellia]
 gi|194193114|gb|EDX06690.1| GD25870 [Drosophila simulans]
          Length = 393

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQRPKRERIIEIIRDAVAIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVAEYQR 375


>gi|163781846|ref|ZP_02176846.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883066|gb|EDP76570.1| ribonucleotide reductase beta chain [Hydrogenivirga sp. 128-5-R1-1]
          Length = 350

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 2/137 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M    +Q +YI RDE  H+    ++I  ++ E P L++ E ++        A   EI + 
Sbjct: 214 MTNTVQQIKYINRDELTHVTLFRNMILNLQKEQPELFSPEIKKWIAEYFRYAIDQEIKWG 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-N 118
                   +G+N    ++Y++++ N R  QIGLEPL+ + TENP  W+ +   +   K +
Sbjct: 274 QYVTQDQILGINNQLIDRYIKYLGNLRITQIGLEPLYPEITENPMKWIDDFRKINNTKTD 333

Query: 119 FFETRVTEYQQGAGLKW 135
           FF+ +   Y +   LKW
Sbjct: 334 FFQRKPQTYAKANELKW 350


>gi|328771482|gb|EGF81522.1| hypothetical protein BATDEDRAFT_16297 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 336

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 71/132 (53%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +         K      + ++HEA  +E  ++
Sbjct: 198 MPGLTFSNELISRDEGLHTDFACLLFTLLN-------NKPTDSVIQQIIHEAVTIEQEFS 250

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY-TENPFPWMSEVIDLKKEKNF 119
            E++P   +G+NA   +QY++F+A+R   ++G+    KY   NPF +M ++I L+ + NF
Sbjct: 251 TESLPVALIGMNANLMKQYIEFVADRLFIELGMPK--KYGVGNPFDFM-DMISLQGKTNF 307

Query: 120 FETRVTEYQQGA 131
           FE RV EYQ+  
Sbjct: 308 FEKRVGEYQKSG 319


>gi|326437649|gb|EGD83219.1| ribonucleotide reductase M2 B [Salpingoeca sp. ATCC 50818]
          Length = 408

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  + I RDE LH +F   + + +  + P       +++   ++ +A  +E  + 
Sbjct: 268 MPGLTQSNELISRDEGLHCDFACLMFSMLHKKPP-------KERVIGIIMDAVEIEQEFL 320

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    +Y++F+++R    +G + ++  T NPFP+M E I ++ + NFF
Sbjct: 321 TEALPVSLLGMNSTLMREYIEFVSDRLLVSLGYDKVYNAT-NPFPFM-ENISIEGKTNFF 378

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+  
Sbjct: 379 ERRVSEYQKSG 389


>gi|217034470|ref|ZP_03439882.1| hypothetical protein HP9810_890g15 [Helicobacter pylori 98-10]
 gi|216943072|gb|EEC22549.1| hypothetical protein HP9810_890g15 [Helicobacter pylori 98-10]
 gi|317177841|dbj|BAJ55630.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           pylori F16]
          Length = 341

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+T +   +   M  +A  +E  + 
Sbjct: 205 MLGSAQMIRFIQRDEVTHLILFQNMINALRNERADLFTPQLINEVIGMFKKAVEIESLWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL +   EQY+QF+A+ R  ++G+  ++   ++P  W+       +++ NF
Sbjct: 265 DYITQGKILGLTSSLIEQYIQFLADSRLSKVGIAKVYG-VQHPIKWVESFSSFNEQRSNF 323

Query: 120 FETRVTEYQQGA 131
           FE RV+ Y +G+
Sbjct: 324 FEARVSNYAKGS 335


>gi|110636874|ref|YP_677081.1| ribonucleoside-diphosphate reductase 1 subunit beta [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110279555|gb|ABG57741.1| ribonucleoside-diphosphate reductase 1, beta subunit [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 324

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   +  +      ++  K   ++   ++ EA  +E  + 
Sbjct: 186 MPGLSFSNELISRDEGLHCDFACLLYTK------YINNKLPAERVIQIILEAVEIEKEFV 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+NA   +QY++F+A+R    +G+   F  T NPF +M E+I L+ + NFF
Sbjct: 240 TDSLPVDLIGMNARLMQQYIEFVADRLLVALGVPKQFNAT-NPFDFM-EMISLQGKTNFF 297

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+  
Sbjct: 298 EKRVSEYQKSG 308


>gi|195401438|ref|XP_002059320.1| GJ18335 [Drosophila virilis]
 gi|194142326|gb|EDW58732.1| GJ18335 [Drosophila virilis]
          Length = 394

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQRPCRERIIEIISDAVTIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     +Y++F+A+R   ++G+  L+  T+NPF +M E+I L  + NFF
Sbjct: 310 TDALPVNLIGMNCALMSEYIEFVADRLLVELGVGKLYN-TKNPFTFM-EMISLDGKTNFF 367

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 368 EKKVGEYQR 376


>gi|328872436|gb|EGG20803.1| ribonucleotide reductase small subunit [Dictyostelium fasciculatum]
          Length = 335

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 72/134 (53%), Gaps = 9/134 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + N++   N  L  K  +    +++ +A   E  + 
Sbjct: 189 MPGLTFSNELISRDEGLHCDFACLLYNKL---NNKLDVKTIE----SIIRDAVECEKEFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   +G+N+    +Y++F A+R    +G + ++  + NPF WM E+I L ++ NFF
Sbjct: 242 TDSLPVDLIGMNSREMSKYIEFCADRLLVSLGYKKIYN-SANPFDWM-EMISLMRKANFF 299

Query: 121 ETRVTEYQQGAGLK 134
           E +V+EY +    K
Sbjct: 300 EGKVSEYAKAGVAK 313


>gi|255530602|ref|YP_003090974.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
 gi|255343586|gb|ACU02912.1| Ribonucleoside-diphosphate reductase [Pedobacter heparinus DSM
           2366]
          Length = 324

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 69/133 (51%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE  H  F   +   +K        K  Q++   ++ +A  +E  + 
Sbjct: 185 MPGLTFSNELISRDEGSHCEFACLLYGMLK-------NKLSQEQVHGIIRDAVEIEKEFV 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R   ++G   ++  T NPF +M E+I L+ + NFF
Sbjct: 238 TDALPVALIGMNAKLMSQYIEFVADRWLQELGYSKIYNAT-NPFDFM-EMISLQGKTNFF 295

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 296 EKRVGDYQKSGVL 308


>gi|195172750|ref|XP_002027159.1| GL20023 [Drosophila persimilis]
 gi|198459455|ref|XP_001361381.2| GA21447 [Drosophila pseudoobscura pseudoobscura]
 gi|194112972|gb|EDW35015.1| GL20023 [Drosophila persimilis]
 gi|198136695|gb|EAL25959.2| GA21447 [Drosophila pseudoobscura pseudoobscura]
          Length = 391

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 72/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + + +       HL  +  +++   ++ +A  +E  + 
Sbjct: 254 MPGLTFSNELISRDEGLHCDFAVLMYH-------HLVQRPKRERIIEIIRDAVEIEQEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 307 TEALPVNLIGMNCVLMSQYIEFVADRLLGELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 364

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 365 EKKVAEYQR 373


>gi|154296564|ref|XP_001548712.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
 gi|150843273|gb|EDN18466.1| ribonucleotide reductase small subunit [Botryotinia fuckeliana
           B05.10]
          Length = 407

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ EA  +E  + 
Sbjct: 254 MAGLTFSNELISRDEGLHTDFACLLFS-------HLKHRPSKQAVQDVITEAVEIEQEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G +  +K + NPF +M E I L  + NFF
Sbjct: 307 TEALPCALLGMNSNLMKQYIEFVADRLLLSLGNDKYYK-SANPFDFM-ENISLAGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 365 EKRVGDYQKAG 375


>gi|307295356|ref|ZP_07575195.1| Ribonucleoside-diphosphate reductase [Sphingobium chlorophenolicum
           L-1]
 gi|306878859|gb|EFN10078.1| Ribonucleoside-diphosphate reductase [Sphingobium chlorophenolicum
           L-1]
          Length = 351

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  +    ++     T   +     M  +   +E A+ 
Sbjct: 178 MKGMGQIVSWSVRDETLHCE-GIIRLFHAFVKERDCLTASVKDDIMDMCQKTVRIEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL+P++   E+P PW++ +++  +  NF
Sbjct: 237 DLVFEMGPVPGMTPKDIKKYVRYIADWRLGQLGLKPIYMIDEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|157939640|ref|YP_001497012.1| ribonucleotide reductase [Tanapox virus]
 gi|146746356|gb|ABQ43492.1| ribonucleotide reductase [Tanapox virus]
 gi|146746512|gb|ABQ43647.1| ribonucleotide reductase [Tanapox virus]
          Length = 325

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         I   HL         R ++ EA  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFAC-------IMFKHLLNPPLNSVVRDIIIEAVNIEKNFL 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G    +  ++NPF +M E I L+ + NFF
Sbjct: 241 TEAIPVKLIGMNCDLMKQYIEFVADRLLLELGCNKYY-CSKNPFDFM-ENISLEGKTNFF 298

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 299 EKRVSEYQK 307


>gi|325953830|ref|YP_004237490.1| ribonucleoside-diphosphate reductase [Weeksella virosa DSM 16922]
 gi|323436448|gb|ADX66912.1| Ribonucleoside-diphosphate reductase [Weeksella virosa DSM 16922]
          Length = 323

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 73/132 (55%), Gaps = 10/132 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDV-INQIKIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   + +N +K + P       ++  + ++ +A  +E  +
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLLYVNHLKNKLP-------EETVQKIIADAVEVEKEF 236

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             E +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M E+I L+ + NF
Sbjct: 237 VTEALPVRLIGMNAELMCQYIEFVADRLLDALGCKKVWNAT-NPFDFM-ELISLQGKTNF 294

Query: 120 FETRVTEYQQGA 131
           FE RV EYQ+  
Sbjct: 295 FERRVGEYQKSG 306


>gi|50311465|ref|XP_455757.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644893|emb|CAG98465.1| KLLA0F15103p [Kluyveromyces lactis]
          Length = 401

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +   +K + NP +  K        ++ EA  +E  Y
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLFAHLKNKPNPEIVEK--------IITEAVEIEKRY 310

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L  + NF
Sbjct: 311 FMDALPVSLLGMNADLMNQYVEFVADRLLVALGNKKYFNVT-NPFDFM-ENISLAGKTNF 368

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+  
Sbjct: 369 FEKRVSDYQKAG 380


>gi|116191729|ref|XP_001221677.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
 gi|88181495|gb|EAQ88963.1| hypothetical protein CHGG_05582 [Chaetomium globosum CBS 148.51]
          Length = 409

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q    ++ +A  +E  + 
Sbjct: 259 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQIIEDIIVDAVRIEQEFL 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G E +++ T NPF +M E I L  + NFF
Sbjct: 312 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNEKVYRST-NPFDFM-ENISLGGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 370 EKRVGEYQKAG 380


>gi|9633826|ref|NP_051904.1| gp015L [Rabbit fibroma virus]
 gi|6578545|gb|AAF17899.1|AF170722_17 gp015L [Rabbit fibroma virus]
          Length = 322

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 72/137 (52%), Gaps = 10/137 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     + ++  ++ EA ++E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCDFACLMFK-------HLNHTPSETRATDIIKEAVVIEQQFL 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G   +F  T NPF +M E I L+ + NFF
Sbjct: 239 TKALPVRLIGINCDLMCQYIEFVADRLVTELGYSKIFSAT-NPFDFM-ENISLEGKTNFF 296

Query: 121 ETRVTEYQQ-GAGLKWD 136
           E RV++YQ+ G   K D
Sbjct: 297 EKRVSDYQRMGVASKQD 313


>gi|4836362|gb|AAD30422.1|AF117061_1 ribonucleotide reductase R2 subunit [Aedes albopictus]
          Length = 398

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  Q++   ++ EA L+E  + 
Sbjct: 261 MPGLTFSNELISRDEGLHTDFACLMFK-------YLVQKPSQERVIEIIREAVLIEQEFL 313

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F A+R   ++G++ ++  T+NPF +M E I L+ + NFF
Sbjct: 314 TKALPVDLLGMNCELMSQYIEFEADRLLLELGIDKIYN-TKNPFSFM-EFISLEGKTNFF 371

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 372 EKKVGEYQK 380


>gi|289449785|ref|YP_003474451.1| ribonucleoside-diphosphate reductase subunit beta [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
 gi|289184332|gb|ADC90757.1| ribonucleoside-diphosphate reductase, beta subunit [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
          Length = 400

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 70/139 (50%), Gaps = 8/139 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    ++++++++E P L++ E  ++ R M+ E    EIA+ 
Sbjct: 260 MPGSVQEIRYINRDENTHLWLFRNILSELQVERPDLFSAELVEEYRAMIKEGAEQEIAWG 319

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
           H  +     GL       Y+Q++AN R   +G    + Y +N        W+S+  D   
Sbjct: 320 HYVLGDDIPGLTRQMVTDYIQYLANLRAQNLGFA--YIYPDNHSEPASMSWISQYSDANM 377

Query: 116 EK-NFFETRVTEYQQGAGL 133
            K +FFE + T Y +   +
Sbjct: 378 VKTDFFEAKSTAYAKSTAM 396


>gi|224100309|ref|XP_002311826.1| predicted protein [Populus trichocarpa]
 gi|222851646|gb|EEE89193.1| predicted protein [Populus trichocarpa]
          Length = 342

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++    H W     QK   ++ EA  +E  + 
Sbjct: 201 MPGLTFSNELISRDEGLHCDFACLLYSLLQ-RQLH-W-----QKVYHIVGEAVEIETKFV 253

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA     Y++F+A+R    +G +  +   ENPF WM E I L+ + NFF
Sbjct: 254 CEALPCALIGMNATLMGDYIKFVADRLLVALGYQKKYN-VENPFDWM-EFISLQGKANFF 311

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 312 ERRVGDYQKAS 322


>gi|94495782|ref|ZP_01302361.1| ribonucleotide reductase beta subunit [Sphingomonas sp. SKA58]
 gi|94424474|gb|EAT09496.1| ribonucleotide reductase beta subunit [Sphingomonas sp. SKA58]
          Length = 350

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  +    ++     T   +     M  +   +E A+ 
Sbjct: 178 MKGMGQIVSWSVRDETLHCE-GIVRLFHAFVKERDCLTASVKDDIMDMCQKTVRIEDAFV 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL+P++   E+P PW++ +++  +  NF
Sbjct: 237 DLVFEMGPVPGMTPKDIKKYVRYIADWRLGQLGLKPIYMIDEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRSTEYSKAA 308


>gi|18079279|ref|NP_525111.1| ribonucleoside diphosphate reductase small subunit [Drosophila
           melanogaster]
 gi|12644287|sp|P48592|RIR2_DROME RecName: Full=Ribonucleoside-diphosphate reductase subunit M2;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|10727628|gb|AAF58599.2| ribonucleoside diphosphate reductase small subunit [Drosophila
           melanogaster]
 gi|15292183|gb|AAK93360.1| LD41588p [Drosophila melanogaster]
 gi|220946286|gb|ACL85686.1| CG8975-PA [synthetic construct]
 gi|220955972|gb|ACL90529.1| RnrS-PA [synthetic construct]
          Length = 393

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQRPKRERIIEIIRDAVAIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVGEYQR 375


>gi|195485577|ref|XP_002091148.1| GE13485 [Drosophila yakuba]
 gi|194177249|gb|EDW90860.1| GE13485 [Drosophila yakuba]
          Length = 393

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQRPKRERIIEIIRDAVAIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVGEYQR 375


>gi|194883840|ref|XP_001976005.1| GG22616 [Drosophila erecta]
 gi|190659192|gb|EDV56405.1| GG22616 [Drosophila erecta]
          Length = 393

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +   ++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQRPKHERIIEIIRDAVAIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVAEYQR 375


>gi|322510501|gb|ADX05815.1| putative ribonucleotide reductase small subunit [Organic Lake
           phycodnavirus 1]
          Length = 324

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 79/128 (61%), Gaps = 9/128 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE+LH  F + + ++++        K  ++K R ++ EA ++E  + 
Sbjct: 189 MPGLTFSNELISRDEALHTEFAVHLFHKLE-------KKINKKKIREIIEEAVVIEKEFI 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++++A+R   Q+G E +++ T NPF +M E+I L+++ NFF
Sbjct: 242 VESLPCRLIGMNSDLMTQYIEYVADRLMIQLGCEEIYR-TNNPFDFM-ELISLEQKTNFF 299

Query: 121 ETRVTEYQ 128
           E+RV+EY 
Sbjct: 300 ESRVSEYS 307


>gi|68161126|gb|AAY86994.1| ribonucleotide reductase M2b [Ictalurus punctatus]
          Length = 192

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 69/126 (54%), Gaps = 9/126 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH NF   + +Q++        K    + + ++ +A  +E  + 
Sbjct: 76  MPGLTYSNELISRDEGLHCNFACLIYSQLQ-------KKPSADRVKDIITKAVRIEQEFL 128

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G+  +++  ENPF +M E I L+ + NFF
Sbjct: 129 TEALPVDLIGINSYLMKQYIEFVADRLLTDLGIPKVYE-AENPFDFM-EFISLEGKTNFF 186

Query: 121 ETRVTE 126
           E RV E
Sbjct: 187 EKRVAE 192


>gi|297818266|ref|XP_002877016.1| hypothetical protein ARALYDRAFT_484491 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322854|gb|EFH53275.1| hypothetical protein ARALYDRAFT_484491 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 329

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K +         +++ ++++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCDFACLLYTLLKTKLS-------EERVKSIVCDAVEIEREFV 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++  T NPF WM E+I L+ + NFF
Sbjct: 239 CDALPCALVGMNRDLMSQYIEFVADRLLGALGYGKVYGVT-NPFDWM-ELISLQGKTNFF 296

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 297 EKRVGDYQKAS 307


>gi|87198296|ref|YP_495553.1| ribonucleotide-diphosphate reductase subunit beta [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133977|gb|ABD24719.1| Ribonucleoside-diphosphate reductase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 351

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH   GI  +    ++     TK  ++       +   LE A+ 
Sbjct: 178 MKGMGQIVSWSVRDESLHCE-GITRLFHAFVKERGCLTKAVKEDIIDCCQKTVRLEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                +G V G++A   ++Y+++IA+ R  Q+GL  ++   ++P PW++ +++  +  NF
Sbjct: 237 DLAFEQGPVPGMSAKEIKRYIRYIADWRLSQLGLPAIYMIEDHPLPWLAPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|225849393|ref|YP_002729557.1| ribonucleoside-diphosphate reductase subunit beta
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644764|gb|ACN99814.1| ribonucleoside-diphosphate reductase, beta subunit
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 326

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 3/129 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK-EFQQKSRTMLHEATLLEIAY 59
           M  +    + I+ DESLHL  GI+ I  +  ENP +     F +  R  + +A  LE+ Y
Sbjct: 196 MKNVVAGVELILIDESLHLQNGIEAILTMVEENPEIVDDYNFVENIRQSIIDAVELELNY 255

Query: 60  AHETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKN 118
                    + G++    E+YM++IA+RR  ++G +P F   +NP  ++ +  D+KK  N
Sbjct: 256 LKTKFGGTTIFGVSYNELERYMKYIADRRLVELGFDPQFGIDQNPLKFLQKE-DVKKLTN 314

Query: 119 FFETRVTEY 127
           FFE   TEY
Sbjct: 315 FFEVSSTEY 323


>gi|148912897|ref|YP_001293211.1| hypothetical protein GTPV_gp017 [Goatpox virus Pellor]
          Length = 321

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K    +          + +++EA  +E  + 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLIFKHLKYPPSN-------DIIKIIINEAVSIEKEFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++FIA+R   ++G + +F  T NPF +M E I L+ + NFF
Sbjct: 237 TNIIPVKLIGMNCDLMSQYIEFIADRLLLELGCDKVFMST-NPFDFM-ENISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 295 EKRVSEYQK 303


>gi|15232077|ref|NP_189342.1| TSO2 (TSO meaning 'ugly' in Chinese); oxidoreductase/
           ribonucleoside-diphosphate reductase/ transition metal
           ion binding [Arabidopsis thaliana]
 gi|75273949|sp|Q9LSD0|RIR2C_ARATH RecName: Full=Ribonucleoside-diphosphate reductase small chain C;
           AltName: Full=Ribonucleoside-diphosphate reductase TSO2
           subunit; AltName: Full=Ribonucleotide reductase small
           subunit C
 gi|9279629|dbj|BAB01087.1| ribonucleotide reductase [Arabidopsis thaliana]
 gi|17380726|gb|AAL36193.1| putative ribonucleotide reductase small subunit [Arabidopsis
           thaliana]
 gi|21436297|gb|AAM51287.1| putative ribonucleotide reductase small subunit [Arabidopsis
           thaliana]
          Length = 332

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K +         +++ ++++ +A  +E  + 
Sbjct: 189 MPGLTFSNELISRDEGLHCDFACLLYTLLKTKLS-------EERVKSIVCDAVEIEREFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++  T NPF WM E+I L+ + NFF
Sbjct: 242 CDALPCALVGMNRDLMSQYIEFVADRLLGALGYGKVYGVT-NPFDWM-ELISLQGKTNFF 299

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 300 EKRVGDYQKAS 310


>gi|190896536|gb|ACE96781.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896560|gb|ACE96793.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896566|gb|ACE96796.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896528|gb|ACE96777.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896544|gb|ACE96785.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|327403795|ref|YP_004344633.1| Ribonucleoside-diphosphate reductase [Fluviicola taffensis DSM
           16823]
 gi|327319303|gb|AEA43795.1| Ribonucleoside-diphosphate reductase [Fluviicola taffensis DSM
           16823]
          Length = 324

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   +  +      HL  +  +++ + ++ +A  +E  + 
Sbjct: 186 MPGLSFSNELISRDEGLHCDFACLLYTK------HLIHQLSKEQVQEIILDAVEIEKEFV 239

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R   ++G   +F  T NPF +M ++I ++ + NFF
Sbjct: 240 TDALPVKLIGMNADLMAQYIEFVADRLLTELGNPKVFN-TTNPFDFM-DMISIQGKTNFF 297

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 298 EKRVAEYQKSG 308


>gi|190896512|gb|ACE96769.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896530|gb|ACE96778.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|187607401|ref|NP_001119973.1| ribonucleotide reductase M2 B (TP53 inducible) [Xenopus (Silurana)
           tropicalis]
 gi|165971068|gb|AAI58191.1| LOC100144925 protein [Xenopus (Silurana) tropicalis]
          Length = 346

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  K  +++   ++  A  +E  + 
Sbjct: 209 MPGLTFSNELISRDEGLHTDFACLMFH-------YLVKKPTEERVTEIIVNAVRIEQEFL 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    + Y++F+A+R   ++G    FK  ENPF +M E I L+ + NFF
Sbjct: 262 TEALPVSLIGMNCTLMKTYIEFVADRLLVELGCSKAFK-AENPFDFM-ENISLEGKTNFF 319

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+ A
Sbjct: 320 EKRVSEYQRFA 330


>gi|308806626|ref|XP_003080624.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
 gi|116059085|emb|CAL54792.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
          Length = 241

 Score = 68.6 bits (166), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   ++ Q+    P       ++  R ++ EA  +E  + 
Sbjct: 101 MPGLTFSNELISRDEGLHRDFAC-LLYQMLNNKPD------EEVVRKIVTEAVEIEKEFV 153

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   VG+NA     Y++++A+     +G+ P    T NPF WM E+I L+ + NFF
Sbjct: 154 CDSLPCALVGMNAGMMSDYIEYVADHLFTSLGM-PKEYNTANPFDWM-ELISLQGKTNFF 211

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 212 EKRVGEYQKAG 222


>gi|190896524|gb|ACE96775.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896534|gb|ACE96780.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|313844096|ref|YP_004061759.1| hypothetical protein OlV1_126 [Ostreococcus lucimarinus virus OlV1]
 gi|312599481|gb|ADQ91503.1| hypothetical protein OlV1_126 [Ostreococcus lucimarinus virus OlV1]
          Length = 408

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 70/127 (55%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F +++   ++I       K   +   +++ EA  +E  + 
Sbjct: 275 MPGLCFSNELISRDEGLHQEFAVELFKLLRI-------KPTTETIHSIVKEAVEIEKGFI 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++++++R   QIG+ P++  ++NPF +M E I L  + NFF
Sbjct: 328 LDALPCALIGMNSEKMSEYIEYVSDRLLKQIGVPPIWN-SKNPFDFM-ENISLDGKTNFF 385

Query: 121 ETRVTEY 127
           E RV +Y
Sbjct: 386 EKRVGDY 392


>gi|255080138|ref|XP_002503649.1| predicted protein [Micromonas sp. RCC299]
 gi|226518916|gb|ACO64907.1| predicted protein [Micromonas sp. RCC299]
          Length = 324

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 72/131 (54%), Gaps = 11/131 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   + + +K   +P         + + ++ +A  +E  +
Sbjct: 180 MRGLTFSNELISRDEGLHCDFACLLYSMLKHPLDP--------ARLQEIVKDAVDIEKEF 231

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +    VG+NA    +Y++F+A+R   Q+G+E ++  T NPF WM E+I L+ + NF
Sbjct: 232 VCDALSCALVGMNADLMSEYIEFVADRLMTQLGVEKVWN-TPNPFEWM-EMISLQGKANF 289

Query: 120 FETRVTEYQQG 130
           FE RV +YQ+ 
Sbjct: 290 FEHRVDQYQKA 300


>gi|303272255|ref|XP_003055489.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226463463|gb|EEH60741.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 322

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +K    H    E  Q+   ++ +A  +E  + 
Sbjct: 180 MRGLTFSNELISRDEGLHCDFACLLYSMLK----HPLEPERLQE---IVKDAVEIEKEFV 232

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +    VG+NA    +Y++F+A+R   Q+G++ ++  T NPF WM E I L+ + NFF
Sbjct: 233 CDALSCALVGMNADLMSEYIEFVADRLLVQLGVDKVWN-TPNPFDWM-ESISLQGKTNFF 290

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 291 ERRVGEYQRNG 301


>gi|89097912|ref|ZP_01170799.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           NRRL B-14911]
 gi|89087414|gb|EAR66528.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           NRRL B-14911]
          Length = 353

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (50%), Gaps = 4/130 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE LH++  + +  +I  E P   TKE  + + +   EA  LEI +A
Sbjct: 212 MVATSTMINYINRDEQLHVDLFVKIFREILDEYPEQNTKELAEFAESTFREAAYLEIEWA 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE-NPFPWMS--EVIDLKKEK 117
              +     G+     E+Y++F AN R +Q+G    F+ +  NP  W+   E +DL K  
Sbjct: 272 RSIIGDKISGILIGDVEEYIRFYANVRSNQLGFNRPFEGSRTNPLRWIKAYEEVDLGK-S 330

Query: 118 NFFETRVTEY 127
           +FFE +  +Y
Sbjct: 331 DFFEQKPRQY 340


>gi|312381384|gb|EFR27142.1| hypothetical protein AND_06323 [Anopheles darlingi]
          Length = 390

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++   ++ +A ++E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHCDFACLMFK-------YLVQKPSRKRVTDIIRDAVMIEQEFL 305

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G E ++  T+NPF +M E I L+ + NFF
Sbjct: 306 TKALPVDMLGMNCELMSQYIEFVADRLLVELGCEKVYN-TKNPFSFM-EFISLEGKTNFF 363

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 364 EKKVGEYQK 372


>gi|85375147|ref|YP_459209.1| ribonucleotide-diphosphate reductase subunit beta [Erythrobacter
           litoralis HTCC2594]
 gi|84788230|gb|ABC64412.1| ribonucleotide reductase beta subunit [Erythrobacter litoralis
           HTCC2594]
          Length = 356

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 72/132 (54%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    + + ++  +     +TK  ++    +  ++  LE  + 
Sbjct: 178 MKGMGQIVSWSVRDESLHCEGIVRLFHEF-VRERDCYTKAVKEDIIDICQKSVRLEDNFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL+P++   ++P PW++ +++  +  NF
Sbjct: 237 DLAFEMGPVSGMTPKEIKKYIRYIADWRLGQLGLQPIYMVDDHPLPWLAPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 297 FEQRATEYSKGA 308


>gi|56551339|ref|YP_162178.1| ribonucleotide-diphosphate reductase subunit beta [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|241760992|ref|ZP_04759081.1| Ribonucleoside-diphosphate reductase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753042|ref|YP_003225935.1| ribonucleotide-diphosphate reductase subunit beta [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|56542913|gb|AAV89067.1| Ribonucleoside-diphosphate reductase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374611|gb|EER64072.1| Ribonucleoside-diphosphate reductase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552405|gb|ACV75351.1| Ribonucleoside-diphosphate reductase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 345

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH   GI  +     +     TK+ +     +      +E A+ 
Sbjct: 178 MKGMGQIVSWSVRDESLHCE-GIIRLFHTFCQERQCLTKQVKDDILNICQRTVRIEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL P++   E+P PW++ +++  +  NF
Sbjct: 237 DLVFEMGPVEGMTPKEIKKYIRYIADWRLGQLGLSPIYMIEEHPLPWLTPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRSTEYSKAA 308


>gi|154149104|ref|YP_001405803.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           hominis ATCC BAA-381]
 gi|153805113|gb|ABS52120.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           hominis ATCC BAA-381]
          Length = 340

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+  +   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFNDKNIAKIYEMFEKAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +GL     E+Y+ ++ + R   IGL   +    +P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGLTDEIIEEYIHYLVDNRLSAIGLNKKYN-ARHPIKWVDDFAKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|302696699|ref|XP_003038028.1| hypothetical protein SCHCODRAFT_12788 [Schizophyllum commune H4-8]
 gi|300111725|gb|EFJ03126.1| hypothetical protein SCHCODRAFT_12788 [Schizophyllum commune H4-8]
          Length = 377

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 69/130 (53%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H  F   + + ++   PH          + ++ EA  +E  + 
Sbjct: 245 MPGLTFSNELISRDEGMHTEFACLLFSHLR-HRPH------PSVVQRIVKEAVAIEHEFL 297

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R  + +G   ++  T NPF +M ++I L+ + NFF
Sbjct: 298 SDALPVSLIGMNAALMRQYIEFVADRLLYSLGQNKIYNAT-NPFDFM-DMISLQGKTNFF 355

Query: 121 ETRVTEYQQG 130
           E RV+EY + 
Sbjct: 356 EKRVSEYAKA 365


>gi|302678465|ref|XP_003028915.1| hypothetical protein SCHCODRAFT_83117 [Schizophyllum commune H4-8]
 gi|300102604|gb|EFI94012.1| hypothetical protein SCHCODRAFT_83117 [Schizophyllum commune H4-8]
          Length = 331

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   +   ++   PH          R ++ EA  +E  + 
Sbjct: 190 MPGLTFSNELITRDEGMHTDFACLLFAHLR-RRPH------PDVVRRIIMEAVTIEQEFL 242

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G E ++  T NPF +M ++I L+ + NFF
Sbjct: 243 TDALPVSLIGMNSTLMCQYIEFVADRLLVALGNEKVYNVT-NPFDFM-DMISLQGKTNFF 300

Query: 121 ETRVTEYQQGA 131
           E RV++Y+  A
Sbjct: 301 EKRVSDYKMAA 311


>gi|170032272|ref|XP_001844006.1| ribonucleoside-diphosphate reductase small chain [Culex
           quinquefasciatus]
 gi|167872122|gb|EDS35505.1| ribonucleoside-diphosphate reductase small chain [Culex
           quinquefasciatus]
          Length = 391

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  +++   ++ EA ++E  + 
Sbjct: 254 MPGLTFSNELISRDEGLHTDFACLMFR-------YLVQKPSKERVLEIIREAVVIEQEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G E ++  T+NPF +M E I L+ + NFF
Sbjct: 307 TKALPVDLLGMNCELMSQYIEFVADRLLLELGNEKIYN-TKNPFSFM-EFISLEGKTNFF 364

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 365 EKKVGEYQK 373


>gi|224372455|ref|YP_002606827.1| ribonucleotide-diphosphate reductase subunit beta [Nautilia
           profundicola AmH]
 gi|223589410|gb|ACM93146.1| ribonucleoside-diphosphate reductase, beta subunit [Nautilia
           profundicola AmH]
          Length = 346

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  H     ++  +IK E P L+T E  +  + ML+ A  LE  + 
Sbjct: 207 MLGSAQMIRFIQRDEVTHTLLFANIFKEIKKEFPDLFTPEVIKNIKDMLYAAYELERDWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYT--ENPFPWMSEVIDLKKEK- 117
                   +G++    +++ Q++AN+R   +GL+ LF     +NP  W        ++K 
Sbjct: 267 WYITNDEILGMSKELIDRFTQYLANKRAQAMGLDLLFPEVGLKNPISWFDGFSSFNEQKT 326

Query: 118 NFFETRVTEYQQGA 131
           NFFE  V  Y +G+
Sbjct: 327 NFFEGNVVNYSKGS 340


>gi|156839886|ref|XP_001643629.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114248|gb|EDO15771.1| hypothetical protein Kpol_478p6 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 394

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K        ++ EA  +E  Y 
Sbjct: 252 MPGLTFSNELICRDEGLHTDFASLLFS-------HLDNKPDPAIVEKIVTEAVEIEKRYF 304

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G E  +K  ENPF +M E I L  + NFF
Sbjct: 305 IDALPVALLGMNAKLMNQYVEFVADRLLVSFGNEKYYK-VENPFDFM-ENISLAGKTNFF 362

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+ +
Sbjct: 363 EKRVSDYQKAS 373


>gi|153952438|ref|YP_001397460.1| ribonucleotide-diphosphate reductase subunit beta [Campylobacter
           jejuni subsp. doylei 269.97]
 gi|152939884|gb|ABS44625.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           jejuni subsp. doylei 269.97]
          Length = 340

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN +  E P L+  E   K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVHKERPDLFHDENINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ L+   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLSAINLDKLYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|296082342|emb|CBI21347.3| unnamed protein product [Vitis vinifera]
          Length = 227

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 63/108 (58%), Gaps = 6/108 (5%)

Query: 28  QIKIENPH----LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 83
           QI IEN H    L  K  +++ + ++ ++  +E  +  + +P   VG+N+    QY++F+
Sbjct: 102 QIAIENIHSEILLRNKLSEERVKAIVADSVDIEREFVCDALPCALVGMNSALMSQYIEFV 161

Query: 84  ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 131
           A+R    +G   ++  + NPF WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 162 ADRLLGALGYGKMYNVS-NPFDWM-ELISLQGKTNFFEKRVGEYQKAS 207


>gi|195027582|ref|XP_001986661.1| GH20400 [Drosophila grimshawi]
 gi|193902661|gb|EDW01528.1| GH20400 [Drosophila grimshawi]
          Length = 393

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVMMFQ-------HLVQRPSRERIIEIVSDAVTIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     +Y++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCALMSEYIEFVADRLLVELGVGKIYN-TKNPFTFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVGEYQR 375


>gi|74229799|ref|YP_309003.1| ribonucleotide reductase small subunit (rr2) [Trichoplusia ni SNPV]
 gi|72259713|gb|AAZ67484.1| ribonucleotide reductase small subunit (rr2) [Trichoplusia ni SNPV]
          Length = 318

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (52%), Gaps = 7/131 (5%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F     N+   +   L     + K   M  EA  +E  +   
Sbjct: 184 GLTYSNELISRDEGLHTDFACLYYNKYIAKEDKLS----ESKVLNMFKEAVDIEKDFFTN 239

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+NA S  +Y++F+A+R   ++G E  FK T NPF +M+  I L+ + NFFE 
Sbjct: 240 ALPVAMLGMNAHSMCEYIEFVADRLLIELGYEKYFK-TLNPFEFMNN-ISLEGKTNFFEK 297

Query: 123 RVTEYQQ-GAG 132
           RV EY++ GA 
Sbjct: 298 RVGEYKRFGAA 308


>gi|47213105|emb|CAF89525.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 198

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K   Q    ++  A  +E  + 
Sbjct: 61  MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSAQTVGAIIRNAVEIEQEFL 113

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    ++Y++F+A+R   ++G   +++  ENPF +M E I L+ + NFF
Sbjct: 114 TEALPVKLIGMNCQLMKRYIEFVADRLLLELGFAKIYR-AENPFDFM-ENISLEGKTNFF 171

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 172 EKRVGEYQR 180


>gi|294463759|gb|ADE77404.1| unknown [Picea sitchensis]
          Length = 289

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +K       +K  +++ + ++ +A  +E  + 
Sbjct: 148 MPGLTFSNELISRDEGLHCDFACLLYSLLK-------SKLSEERVKAIVRDAVDIEREFV 200

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    VG+NA    QY++FIA+R    +G   ++ + ENPF WM ++I L+ + NFF
Sbjct: 201 CEALSCDLVGMNATLMSQYIKFIADRLLVALGHGKMY-HVENPFDWM-DLISLQGKTNFF 258

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 259 ERRVGDYQKAS 269


>gi|155370982|ref|YP_001426516.1| hypothetical protein ATCV1_Z035L [Acanthocystis turfacea Chlorella
           virus 1]
 gi|155124302|gb|ABT16169.1| hypothetical protein ATCV1_Z035L [Acanthocystis turfacea Chlorella
           virus 1]
          Length = 325

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG  + +  K+EN     K      ++++ EA   E  + 
Sbjct: 189 MPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLDVVKSIVEEAVANEKDFI 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G    F   ENPF +M E+I L+ + NFF
Sbjct: 242 CDAIPCRMIGMNSDLMSQYIEFVADRIFTALGYPKQFG-AENPFDFM-ELISLEGKSNFF 299

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   +  D
Sbjct: 300 ERRVSEYQKAGVMNAD 315


>gi|308485547|ref|XP_003104972.1| hypothetical protein CRE_24501 [Caenorhabditis remanei]
 gi|308257293|gb|EFP01246.1| hypothetical protein CRE_24501 [Caenorhabditis remanei]
          Length = 323

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   +  +I ++ P       ++    ++ EA  +E+ +  +
Sbjct: 188 GLTHSNELISRDEGLHRDFACLLFTKI-VDKPS------REIVCEIVDEAVTIELEFLDQ 240

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+N     QY++++A+    ++G E L+ +T NPF +M E I +  + NFFE 
Sbjct: 241 ALPVNVIGMNYTLMSQYIKYVADHLLEELGFEKLY-HTINPFDFM-ENISIDGKTNFFEK 298

Query: 123 RVTEYQQGA 131
           RV+EYQ+  
Sbjct: 299 RVSEYQRSG 307


>gi|254586079|ref|XP_002498607.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
 gi|238941501|emb|CAR29674.1| ZYRO0G14388p [Zygosaccharomyces rouxii]
          Length = 412

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  +        ++ EA  +E  Y 
Sbjct: 272 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNRPSPDIVERIITEAVSIEKRYF 324

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T NPF +M E I L  + NFF
Sbjct: 325 EDALPVALLGMNAALMNQYVEFVADRLLVALGNEKYYNVT-NPFDFM-ENISLAGKTNFF 382

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 383 EKRVSDYQKAG 393


>gi|323452425|gb|EGB08299.1| hypothetical protein AURANDRAFT_59025 [Aureococcus anophagefferens]
          Length = 319

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 70/130 (53%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   + ++++        K    +  +++  A  +E ++ 
Sbjct: 182 MPGLSFSNELIARDEGLHCDFACLLYSKLR-------KKLSDVQVASIVGAAVDIEKSFV 234

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N+ S  +Y++F A+R   ++G   L+  T NPF WM E+I L+ + NFF
Sbjct: 235 VSALPVELIGMNSKSMCKYIEFCADRLLLELGYSTLYGAT-NPFDWM-ELISLQGKTNFF 292

Query: 121 ETRVTEYQQG 130
           E RV EY + 
Sbjct: 293 EKRVGEYAKA 302


>gi|269963257|ref|ZP_06177590.1| hypothetical protein VME_39740 [Vibrio harveyi 1DA3]
 gi|269832005|gb|EEZ86131.1| hypothetical protein VME_39740 [Vibrio harveyi 1DA3]
          Length = 310

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 14/132 (10%)

Query: 1   MVGIAEQYQYIMRDESLHLNFG---IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 57
           + G+A     I RDE LH +F       + Q K+          QQ+   +  EA  +E 
Sbjct: 178 LAGLAASNDLIARDEGLHFSFSALLFKTLGQGKVT---------QQEFEEICREAVSIEK 228

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P   +G+NA    QY++  A+      G  P+F   ENPF +M  ++D++ + 
Sbjct: 229 EFVTEALPVDLIGMNAELMCQYIEHTADVIAGLFGFTPIFG-AENPFDYM-RLLDMEGKT 286

Query: 118 NFFETRVTEYQQ 129
           NFFE RVTEY++
Sbjct: 287 NFFEKRVTEYKR 298


>gi|57505748|ref|ZP_00371674.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           upsaliensis RM3195]
 gi|57016021|gb|EAL52809.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           upsaliensis RM3195]
          Length = 340

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+ ++   K  +M   A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFNEQNIDKIYSMFKRAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ ++   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLIAINLDKIYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|325475472|gb|EGC78653.1| ribonucleoside-diphosphate reductase [Treponema denticola F0402]
          Length = 351

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I +++ E P L+T +  +  R M+ E    EIA+ 
Sbjct: 211 MPGSVQEIRYINRDENTHLWLFRSMIQELQKEEPQLFTPQNVELFRGMIREGCEQEIAWG 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           +  +     GLN+     Y+Q++ N RC  +G  P++  + E P    W+S+  +    K
Sbjct: 271 NYVIGNDIPGLNSQMITDYIQYLGNLRCENLGFAPIYDGHKEEPQSMSWVSQYSNANLIK 330

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + +
Sbjct: 331 TDFFEAKSTAYAKSSAM 347


>gi|190896572|gb|ACE96799.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896574|gb|ACE96800.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896576|gb|ACE96801.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896578|gb|ACE96802.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEEQVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896570|gb|ACE96798.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896582|gb|ACE96804.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEEQVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-AANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|312075738|ref|XP_003140550.1| ribonucleotide reductase M2 B [Loa loa]
 gi|307764288|gb|EFO23522.1| ribonucleotide reductase M2 B [Loa loa]
          Length = 350

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   IK        K  +++   ++ EA  +E  Y 
Sbjct: 213 MPGLTHSNELISRDEGLHRDFACLLYTYIK-------NKPSEERIYQIIREAVDIEKEYL 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++++A+    ++    ++ Y++NPF +M E I ++ + NFF
Sbjct: 266 TEALPVDLIGINCKLMCQYIEYVADHLLTELHCAKMY-YSDNPFDFM-ERISIEAKTNFF 323

Query: 121 ETRVTEYQQGAGL 133
           E RV+EYQ+   L
Sbjct: 324 EKRVSEYQKAGVL 336


>gi|190896568|gb|ACE96797.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896580|gb|ACE96803.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEEQVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF WM E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-AANPFDWM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|323453718|gb|EGB09589.1| hypothetical protein AURANDRAFT_60022 [Aureococcus anophagefferens]
          Length = 393

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F   + +++     HL   +   ++  ++ EA   E+ +  +
Sbjct: 255 GLGFANELISRDEGLHCDFACALYSRLP---GHLRLSD--AEATAIISEAVDTEVDFVTD 309

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   VG+NA     Y++F+A+R    +G  P      NPF +M E+I ++ + NFFE 
Sbjct: 310 ALPVSLVGMNAKLMTDYVKFVADRLLASLG-HPKIYGAANPFDFM-ELISMQGKTNFFEK 367

Query: 123 RVTEYQQG 130
           RV EYQ+ 
Sbjct: 368 RVAEYQKA 375


>gi|213511642|ref|NP_001133495.1| Ribonucleoside-diphosphate reductase subunit M2 [Salmo salar]
 gi|209154228|gb|ACI33346.1| Ribonucleoside-diphosphate reductase subunit M2 [Salmo salar]
          Length = 387

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  ++    ++  A  +E  + 
Sbjct: 250 MPGLTFSNELISRDEGLHCDFACLMFK-------HLVHKPSKETVTKLIRNAVEIEQEFL 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G + +++  ENPF +M E I L+ + NFF
Sbjct: 303 TKALPVKLIGMNCDLMTQYIEFVADRLMLELGFDKIYR-VENPFDFM-ENISLEGKTNFF 360

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 361 EKRVGEYQR 369


>gi|325831705|ref|ZP_08164922.1| ribonucleoside-diphosphate reductase, beta subunit [Eggerthella sp.
           HGA1]
 gi|325486576|gb|EGC89025.1| ribonucleoside-diphosphate reductase, beta subunit [Eggerthella sp.
           HGA1]
          Length = 347

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+T E  ++ R M+ E    EI + 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFRNILLELKEEEPELFTPELVEEYRAMIKEGCEQEIRWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC Q+G EPL++  E       W+S+  +    K
Sbjct: 267 HYAIGDEVAGLNKQMVTDYIQYLGNLRCTQLGFEPLYEGHEREPESMSWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|298707394|emb|CBJ30029.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 380

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 18/138 (13%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGI----DVINQIKIENPHLWTKEFQQKSRTMLHEATLLE 56
           M G+    + I RDE LH +F       ++N++ +E           +   ++ +A  +E
Sbjct: 243 MPGLCFSNELISRDEGLHTDFACLLFRKLVNKLPVE-----------RVAEIICDAVDIE 291

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
             +    +P   +G+N+    QY++F A+R   ++G E  +  T NPF WM E+I L+ +
Sbjct: 292 KEFITSALPVELIGMNSALMRQYIEFCADRLLMELGCEKKYNST-NPFDWM-EMISLQGK 349

Query: 117 KNFFETRVTEY-QQGAGL 133
            NFFE RV EY + G G+
Sbjct: 350 TNFFEKRVGEYSKSGVGV 367


>gi|315637824|ref|ZP_07893014.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           upsaliensis JV21]
 gi|315482065|gb|EFU72679.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           upsaliensis JV21]
          Length = 340

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+ ++   K  +M   A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFNEQNIDKIYSMFKRAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ ++   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLIAINLDRIYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|257458932|ref|ZP_05624052.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           gracilis RM3268]
 gi|257443636|gb|EEV18759.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           gracilis RM3268]
          Length = 340

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+ K    K   M   A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERADLFNKRNVDKIYEMFETAGNLEIDWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   IGLE  +   ++P  W+ +      +K NF
Sbjct: 264 KYITDNQIMGFTDDIIEEYIHYLVDQRLLAIGLEKRYD-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|9632043|ref|NP_048832.1| hypothetical protein PBCV1_A476R [Paramecium bursaria Chlorella
           virus 1]
 gi|1620147|gb|AAC96843.1| contains ribonucleotide reductase (RR) signature; similar to
           tobacco RR small subunit, corresponds to Swiss-Prot
           Accession Number P49730 [Paramecium bursaria Chlorella
           virus 1]
          Length = 324

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 76/134 (56%), Gaps = 9/134 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG  + ++++ + P        +  + ++ EA   E  + 
Sbjct: 188 MPGLGLSNEFISRDEGLHQQFGELMYSKLQNKLPF-------ETVKQIITEAVENEKEFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E ++  ++NPF +M E+I L+ + NFF
Sbjct: 241 CDAIPCRLIGMNAELMGQYIEFVADRIFVALGYEKVYN-SKNPFAFM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGLK 134
           E RV++YQ+   +K
Sbjct: 299 EKRVSDYQRPGVMK 312


>gi|291239432|ref|XP_002739627.1| PREDICTED: hCG23833-like [Saccoglossus kowalevskii]
          Length = 309

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 9/132 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           + G+ +  ++I RDE LH  F   +  +IK   P         K R ++ E   +E  + 
Sbjct: 178 LAGLTQANEFISRDEGLHCTFACTMYGKIKPRLP-------DTKVRKIVLEGCEVEKLFV 230

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              + K  +G+N+   E Y+ F+ +     +G E  F    NPFP+M   I ++ + NFF
Sbjct: 231 KHALRKPLLGMNSHLMETYVNFVTDNLLTDLGYEKEFG-VNNPFPFMDN-ISMQGKTNFF 288

Query: 121 ETRVTEYQQGAG 132
           E RVTEY +  G
Sbjct: 289 ERRVTEYTRLTG 300


>gi|163801385|ref|ZP_02195284.1| ribonucleoside-diphosphate reductase 1, beta subunit [Vibrio sp.
           AND4]
 gi|159174874|gb|EDP59674.1| ribonucleoside-diphosphate reductase 1, beta subunit [Vibrio sp.
           AND4]
          Length = 310

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 14/132 (10%)

Query: 1   MVGIAEQYQYIMRDESLHLNFG---IDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEI 57
           + G+A     I RDE LH +F       + Q K+          QQ+   +  EA  +E 
Sbjct: 178 LAGLAASNDLIARDEGLHFSFSALLFKTLGQGKVT---------QQEFEEICREAVSIEK 228

Query: 58  AYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            +  E +P   +G+NA    QY++  A+      G  P F  +ENPF +M  ++D++ + 
Sbjct: 229 EFVTEALPVDLIGMNAELMCQYIEHTADVIADLFGFNPAFG-SENPFDYM-RLLDMEGKT 286

Query: 118 NFFETRVTEYQQ 129
           NFFE RVTEY++
Sbjct: 287 NFFEKRVTEYKR 298


>gi|262263187|dbj|BAI48096.1| ribonucleotide reductase M2 [Sus scrofa]
          Length = 355

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 9/128 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +Q+ + ++  A  +E  + 
Sbjct: 235 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHKPSEQRVKEIIVNAVRIEQEFL 287

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N    +QY++F+A+R   ++G   +F+  ENPF +M E I L+ + NFF
Sbjct: 288 TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFGKVFR-VENPFDFM-ENISLEGKTNFF 345

Query: 121 ETRVTEYQ 128
           E RV E +
Sbjct: 346 EKRVGEIR 353


>gi|254293199|ref|YP_003059222.1| ribonucleotide-diphosphate reductase subunit beta [Hirschia baltica
           ATCC 49814]
 gi|254041730|gb|ACT58525.1| Ribonucleoside-diphosphate reductase [Hirschia baltica ATCC 49814]
          Length = 345

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    + + +    E   L TK  +            LE  + 
Sbjct: 187 MKGMGQIVSWSVRDESLHCEGMMKMFHTYAEETGAL-TKTVKDDITDCCQTVVKLEDKFI 245

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     + Y+++IA+ R  Q+ L+P++   E+P PW++E+++  +  NF
Sbjct: 246 DLAFEAGEVEGMTPEDIKNYIRYIADWRLKQLKLDPVYGVDEHPIPWLTEILNGVEHANF 305

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 306 FEARATEYSKGA 317


>gi|305665630|ref|YP_003861917.1| putative ribonucleoside-diphosphate reductase small chain
           [Maribacter sp. HTCC2170]
 gi|88710386|gb|EAR02618.1| probable ribonucleoside-diphosphate reductase small chain
           [Maribacter sp. HTCC2170]
          Length = 328

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 74/136 (54%), Gaps = 8/136 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H ++ +       +   H+  K  +++   ++ +A  +E  + 
Sbjct: 187 MPGLTFSNELISRDEGMHCDYAV------HLHKNHIVNKVTKERITDIIVDALNIEREFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N+    QY++F+ +R   ++  + ++  + NPF +M ++I L+ + NFF
Sbjct: 241 TESLPVSLIGMNSKLMTQYLEFVTDRLLVELECDKVYN-SSNPFDFM-DMISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV+EYQ+   L  D
Sbjct: 299 EKRVSEYQKAGVLNKD 314


>gi|148554425|ref|YP_001262007.1| ribonucleotide-diphosphate reductase subunit beta [Sphingomonas
           wittichii RW1]
 gi|148499615|gb|ABQ67869.1| Ribonucleoside-diphosphate reductase [Sphingomonas wittichii RW1]
          Length = 350

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDE+LH   GI  +    ++     T   +     M  +   +E A+ 
Sbjct: 178 MKGMGQIVTWSIRDETLHCE-GIVRLFHAFVKERDCLTASVKDDILDMCQKTVRIEDAFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+GL+P++   ++P PW++ +++  +  NF
Sbjct: 237 DLVFEMGPVNGMTPKDIKKYVRYIADWRLGQLGLKPIYMIEDHPLPWLAPLLNGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FETR TEY + A
Sbjct: 297 FETRATEYSKAA 308


>gi|268678691|ref|YP_003303122.1| ribonucleoside-diphosphate reductase [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268616722|gb|ACZ11087.1| Ribonucleoside-diphosphate reductase [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 340

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 63/132 (47%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN  K E P L+T   + K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINTTKKERPDLFTDALKAKVYEMFQKAGDLEIEWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E Y+ ++ + R   +G + L+    +P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIETYIHYLVDDRLTAVGFDKLYN-ASHPIKWVDDFSKFNDQKTNF 322

Query: 120 FETRVTEYQQGA 131
           FE  V+ Y +G+
Sbjct: 323 FEGNVSNYSKGS 334


>gi|157952945|ref|YP_001497837.1| hypothetical protein NY2A_B641R [Paramecium bursaria Chlorella
           virus NY2A]
 gi|155123172|gb|ABT15040.1| hypothetical protein NY2A_B641R [Paramecium bursaria Chlorella
           virus NY2A]
          Length = 324

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG       ++    L  K   +  + ++ EA   E  + 
Sbjct: 188 MPGLCLSNEFISRDEGLHQQFG-------ELMYSKLQNKLSFETIKQIIMEAVTNEKEFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E ++  ++NPF +M E+I L+ + NFF
Sbjct: 241 CDAIPCSMIGMNADLMNQYIEFVADRIFTALGYEKVYN-SKNPFAFM-ELISLEGKTNFF 298

Query: 121 ETRVTEYQQ 129
           E RV++YQ+
Sbjct: 299 EKRVSDYQR 307


>gi|310798394|gb|EFQ33287.1| ribonucleotide reductase [Glomerella graminicola M1.001]
          Length = 413

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q  + ++ +A  +E  + 
Sbjct: 263 MPGLTFSNELISRDEGLHTDFACLLYS-------HLKNRPSKQVIQDIIVDAVQIEQEFL 315

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+   +QY++F+A+R    +G + ++K + NPF +M E I L  + NFF
Sbjct: 316 TEALPCALLGMNSNLMKQYIEFVADRLLVALGNDKVYK-SSNPFDFM-ENISLGGKTNFF 373

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 374 EKRVADYQKAG 384


>gi|288800286|ref|ZP_06405744.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella sp.
           oral taxon 299 str. F0039]
 gi|288332499|gb|EFC70979.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella sp.
           oral taxon 299 str. F0039]
          Length = 347

 Score = 67.4 bits (163), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +       M+ E    EIA+ 
Sbjct: 207 MSGSAQEIRYINRDENTHLWLFRNIIQELKKEEPDLFTPDKVAVYEAMMREGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENP---FPWMSEVIDLKKEK 117
              +     GLNA   + Y++++ N R H +G + L++          W+S+  +    K
Sbjct: 267 QYVIGNDIQGLNAQMVDDYIRYLGNLRWHSLGFDYLYEDNRTEPENMRWVSQYSNANMVK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y +   L+ D
Sbjct: 327 TDFFEAKSTAYAKSTALEDD 346


>gi|44971395|gb|AAS49745.1| RPXV032 [Rabbitpox virus]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|6969682|gb|AAF33894.1| TF4L [Vaccinia virus Tian Tan]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE L  +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLRCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    E Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMETYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQQ
Sbjct: 294 EKRVGEYQQ 302


>gi|50545856|ref|XP_500466.1| YALI0B03630p [Yarrowia lipolytica]
 gi|49646332|emb|CAG82692.1| YALI0B03630p [Yarrowia lipolytica]
          Length = 403

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLENRPSKKIVEDVIVEAVGIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P G +G+NA    QY++F+A+R    +G   ++  T NPF +M E I L  + NFF
Sbjct: 313 TDALPCGLLGMNAKLMCQYIEFVADRLLVALGNSKVYNST-NPFDFM-ENISLAGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 371 EKRVSDYQKAG 381


>gi|56713400|gb|AAW23440.1| ribonucleoside-diphosphate reductase [Vaccinia virus]
 gi|56713684|gb|AAW23722.1| ribonucleoside-diphosphate reductase [Vaccinia virus]
 gi|88854075|gb|ABD52493.1| ribonucleoside-diphosphate reductase subunit [Vaccinia virus]
 gi|167412519|gb|ABZ79953.1| ribonucleotide reductase small subunit [Vaccinia virus GLV-1h68]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|308809930|ref|XP_003082274.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
 gi|116060742|emb|CAL57220.1| putative ribonucleotide reductase small subunit (ISS) [Ostreococcus
           tauri]
          Length = 382

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 17/135 (12%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH----EATLLE 56
           M G+    + I RDE LH +F   +   +  +NP          S   LH    +A  +E
Sbjct: 244 MRGLTFSNELISRDEGLHCDFACLLYGML--QNP---------LSEATLHHIVGDAVKIE 292

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
             +  + +    VG+NA     Y++F+A+R   Q+G   LF    NPF WM E+I L+ +
Sbjct: 293 KEFVCDALSCSLVGMNADMMSTYIEFVADRLLIQLGASKLFNAV-NPFDWM-ELISLQGK 350

Query: 117 KNFFETRVTEYQQGA 131
            NFFE RV +YQ+  
Sbjct: 351 ANFFEHRVDQYQKAG 365


>gi|111184227|gb|ABH08147.1| HSPV044 [Horsepox virus]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|20178418|ref|NP_619839.1| CPXV051 protein [Cowpox virus]
 gi|20153036|gb|AAM13497.1|AF482758_48 CPXV051 protein [Cowpox virus]
          Length = 333

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 250 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQK 316


>gi|132628|sp|P20493|RIR2_VACCC RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335366|gb|AAA48018.1| putative F4L [Vaccinia virus Copenhagen]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|56404698|sp|O57175|RIR2_VACCA RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2772676|gb|AAB96415.1| ribonucleotide reductase, small subunit [Vaccinia virus]
 gi|47088360|gb|AAT10430.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|160857924|emb|CAM58212.1| ribonucleotide reductase small subunit [Vaccinia virus Ankara]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|266919|sp|P29883|RIR2_VACCP RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335710|gb|AAA48294.1| F14 [Vaccinia virus]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|90660281|gb|ABD97395.1| ribonucleotide reductase small subunit [Cowpox virus]
          Length = 333

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 250 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQK 316


>gi|22164633|ref|NP_671546.1| EVM028 [Ectromelia virus]
 gi|22123774|gb|AAM92332.1|AF523264_28 EVM028 [Ectromelia virus]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++FIA+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFIADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|15150459|ref|NP_150454.1| LSDV020 ribonucleotide reductase small subunit [Lumpy skin disease
           virus NI-2490]
 gi|15149031|gb|AAK84981.1| LSDV020 ribonucleotide reductase small subunit [Lumpy skin disease
           virus NI-2490]
 gi|22595554|gb|AAN02587.1| ribonucleotide reductase small subunit [Lumpy skin disease virus
           NW-LW]
          Length = 321

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K    +       +    +++EA  +E  + 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLIFKHLKYPPSN-------EIITIIINEAVSIEKEFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++FIA+R   ++G + +F  T NPF +M E I L+ + NFF
Sbjct: 237 TNIIPVKLIGMNCDLMSQYIEFIADRLLLELGCDKVFMST-NPFDFM-ENISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 295 EKRVSEYQK 303


>gi|66275840|ref|YP_232925.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|132629|sp|P11158|RIR2_VACCV RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|335624|gb|AAA48244.1| F4L protein [Vaccinia virus]
 gi|335809|gb|AAA88680.1| ribonucleotide reductase (EC 1.17.4.1) small subunit [Vaccinia
           virus]
 gi|29692149|gb|AAO89322.1| ribonucleotide reductase small subunit [Vaccinia virus WR]
          Length = 319

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|195436539|ref|XP_002066225.1| GK22247 [Drosophila willistoni]
 gi|194162310|gb|EDW77211.1| GK22247 [Drosophila willistoni]
          Length = 395

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  +  +++   ++ +A  +E  + 
Sbjct: 258 MPGLTFSNEMISRDEGLHCDFAVLMFQ-------HLVQRPSRERIIEIIRDAVQIEQEFL 310

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 311 TVALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFSFM-EMISLDGKTNFF 368

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 369 EKKVGEYQR 377


>gi|46446983|ref|YP_008348.1| ribonucleoside-diphosphate reductase small chain [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46400624|emb|CAF24073.1| probable ribonucleoside-diphosphate reductase small chain
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 323

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   + +Q+  + P        +  + ++  A  +E  + 
Sbjct: 186 MPGLSFANELISRDEGLHCDFACLLYSQLNNKLP-------LETLQAIISHAVAIEKEFV 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G   L+   +NPF +M ++I +  + NFF
Sbjct: 239 QDALPVRLIGMNATLMCQYIEFVADRLLVALGSPKLYN-VDNPFDFM-DLISMPGKTNFF 296

Query: 121 ETRVTEYQQGA 131
           E RV+EYQ+  
Sbjct: 297 ERRVSEYQKSG 307


>gi|57168357|ref|ZP_00367491.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           coli RM2228]
 gi|305432773|ref|ZP_07401932.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           coli JV20]
 gi|57020165|gb|EAL56839.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           coli RM2228]
 gi|304444170|gb|EFM36824.1| ribonucleotide-diphosphate reductase beta subunit [Campylobacter
           coli JV20]
          Length = 340

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E P L+ +    K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERPDLFNENNINKIYDMFKKAGDLEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ ++   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLVAINLDKIYN-AKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|22595713|gb|AAN02745.1| ribonucleotide reductase small subunit [lumpy skin disease virus]
          Length = 321

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K    +            +++EA  +E  + 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLIFKHLKYPPSN-------DIITIIINEAVSIEKEFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++FIA+R   ++G + +F  T NPF +M E I L+ + NFF
Sbjct: 237 TNIIPVKLIGMNCVLMSQYIEFIADRLLLELGCDKVFMST-NPFDFM-ENISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 295 EKRVSEYQK 303


>gi|283481249|emb|CAZ69365.1| ribonucleoside-diphosphate reductase small chain [Emiliania huxleyi
           virus 99B1]
          Length = 325

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K   +    ++  A  LE  + 
Sbjct: 184 MPGLTFSNELISRDEGLHTDFAC------MLYRNHIIHKLPYETVLDIITNAVELERLFI 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA S   Y++F+A+R    +G    +    NPF WM E+I L+ + NFF
Sbjct: 238 CEALPVSLIGINAESMSTYIKFVADRLLISLGYAKHYNVV-NPFEWM-ELISLEGKTNFF 295

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 296 EKRVGEYQKAG 306


>gi|13876672|gb|AAK43560.1| ribonucleoside reductase [lumpy skin disease virus]
          Length = 321

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K    +            +++EA  +E  + 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLIFKHLKYPPSN-------DIITIIINEAVSIEKEFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++FIA+R   ++G + +F  T NPF +M E I L+ + NFF
Sbjct: 237 TNIIPVKLIGMNCVLMSQYIEFIADRLLLELGCDKVFMST-NPFDFM-ENISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 295 EKRVSEYQK 303


>gi|73852496|ref|YP_293780.1| ribonucleoside-diphosphate reductase small chain [Emiliania huxleyi
           virus 86]
 gi|72415212|emb|CAI65449.1| ribonucleoside-diphosphate reductase small chain [Emiliania huxleyi
           virus 86]
          Length = 325

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K   +    ++  A  LE  + 
Sbjct: 184 MPGLTFSNELISRDEGLHTDFAC------MLYRNHIIHKLPYETVLDIITNAVELERLFI 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA S   Y++F+A+R    +G    +    NPF WM E+I L+ + NFF
Sbjct: 238 CEALPVSLIGINAESMSTYIKFVADRLLISLGYAKHYNVV-NPFEWM-ELISLEGKTNFF 295

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 296 EKRVGEYQKAG 306


>gi|124010268|ref|ZP_01694921.1| ribonucleoside-diphosphate reductase, beta subunit [Microscilla
           marina ATCC 23134]
 gi|123983653|gb|EAY24093.1| ribonucleoside-diphosphate reductase, beta subunit [Microscilla
           marina ATCC 23134]
          Length = 330

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 72/132 (54%), Gaps = 10/132 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQ-IKIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G++   + I RDE LH +F   + N  IK + P+       +   +++  A  +E  +
Sbjct: 188 MPGLSFSNELISRDEGLHCDFACLLYNSYIKNKLPN-------ETVVSIIKNAVEIEKEF 240

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+N+    +Y++F+A+R   ++G E  +  T NPF +M E+I L+ + NF
Sbjct: 241 VTDALPVKLIGMNSDLMSEYIEFVADRLLVELGCEKQYN-TANPFDFM-EMISLEGKTNF 298

Query: 120 FETRVTEYQQGA 131
           FE RV+EY +  
Sbjct: 299 FEKRVSEYSKAG 310


>gi|256027986|ref|ZP_05441820.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium sp.
           D11]
          Length = 348

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EIA+ 
Sbjct: 208 MVGTSDIIRLINRDELSHVVLFRSIVKEIKNDFPNFFSAE---TVYSMFKTAVEQEIAWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 265 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 325 KSNFFEGTVTSYNMSSSI 342


>gi|149185037|ref|ZP_01863354.1| ribonucleotide reductase beta subunit [Erythrobacter sp. SD-21]
 gi|148831148|gb|EDL49582.1| ribonucleotide reductase beta subunit [Erythrobacter sp. SD-21]
          Length = 352

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + ++   E   L TK  ++    +  +   LE  + 
Sbjct: 178 MKGMGQIVSWSIRDESLHCEGIIRMFHEFVRERDCL-TKAVKEDIIDICQKTVRLEDNFI 236

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     ++Y+++IA+ R  Q+ L+P++   ++P PW++ +I+  +  NF
Sbjct: 237 DLAFEMGPVSGMTPKDIKKYIRYIADWRLGQLNLDPIYMVDDHPLPWLAPLINGVEHANF 296

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 297 FEQRATEYSKGA 308


>gi|311748425|ref|ZP_07722210.1| ribonucleoside-diphosphate reductase, beta subunit [Algoriphagus
           sp. PR1]
 gi|126576938|gb|EAZ81186.1| ribonucleoside-diphosphate reductase, beta subunit [Algoriphagus
           sp. PR1]
          Length = 326

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 73/139 (52%), Gaps = 18/139 (12%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEF-----QQKSRTMLHEATLL 55
           M G+    + I RDE LH +F             HL+TK       ++  R ++ +A  +
Sbjct: 184 MPGLTFSNELISRDEGLHCDFAC-----------HLYTKHVVNPLPKETVREIIIDAVKI 232

Query: 56  EIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKK 115
           E  +  + +P   +G+N+    QY++F+A+R   ++  E ++  T NPF +M ++I L+ 
Sbjct: 233 EKEFVTDALPVRLIGMNSDLMCQYIEFVADRLLLELDCEKVWNST-NPFDFM-DMISLQG 290

Query: 116 EKNFFETRVTEYQQGAGLK 134
           + NFFE RV +YQ+   +K
Sbjct: 291 KTNFFEKRVGDYQKAGVMK 309


>gi|324509007|gb|ADY43795.1| Ribonucleoside-diphosphate reductase small chain [Ascaris suum]
          Length = 337

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 68/134 (50%), Gaps = 9/134 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   IK        K  Q++   ++ EA  LE  Y 
Sbjct: 200 MKGLTHSNELISRDEGLHRDFACLLYKYIK-------HKPSQEQVYEIIKEAVSLEQEYL 252

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++++A+    ++G   ++    NPF +M E + ++ + NFF
Sbjct: 253 TEALPVDLIGMNCRLMSQYIEYVADHLLTELGYPKVYN-ASNPFDFM-ENLSIEAKTNFF 310

Query: 121 ETRVTEYQQGAGLK 134
           E RV+EYQ+   L 
Sbjct: 311 ERRVSEYQRAGVLS 324


>gi|131840053|ref|YP_001096062.1| ORF23 [Cyprinid herpesvirus 3]
 gi|84181618|gb|ABC55221.1| hypothetical protein [Cyprinid herpesvirus 3]
 gi|109706628|gb|ABG42854.1| ORF23 [Cyprinid herpesvirus 3]
 gi|129560539|dbj|BAF48834.1| ribonucleotide reductase small chain [Cyprinid herpesvirus 3]
          Length = 335

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 8/128 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  K  +++ R ++ EA  +E  + 
Sbjct: 196 MPGLTFSNELISRDEGLHRDFACLLFSS------HLRHKPSKERVRAIITEAVEIEKEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            +++P   VG+N     +Y+Q++A+    Q+GL  L+  T  PF +M E I L+ + NFF
Sbjct: 250 TQSLPVSLVGMNHDLMCKYIQYVADHLLCQMGLSRLYN-TPCPFDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQ 128
           E RV +YQ
Sbjct: 308 EKRVADYQ 315


>gi|260497963|ref|ZP_05816079.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_33]
 gi|260196471|gb|EEW94002.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_33]
          Length = 344

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EIA+ 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSIVKEIKNDFPNFFSAE---TVYSMFKTAVEQEIAWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|42525851|ref|NP_970949.1| ribonucleotide-diphosphate reductase subunit beta [Treponema
           denticola ATCC 35405]
 gi|41815901|gb|AAS10830.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           denticola ATCC 35405]
          Length = 351

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I +++ E P L+T +  +  R M+ E    EIA+ 
Sbjct: 211 MPGSVQEIRYINRDENTHLWLFRSMIQELQKEEPQLFTPQNVELFRAMIKEGCEQEIAWG 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN+     Y+Q++ N RC  +G  P++  + E P    W S+  +    K
Sbjct: 271 DYVIGNDIPGLNSQMITDYIQYLGNLRCENLGFAPIYDGHREEPQSMSWASQYSNANLIK 330

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + +
Sbjct: 331 TDFFEAKSTAYAKSSAM 347


>gi|239826135|ref|YP_002948759.1| ribonucleoside-diphosphate reductase [Geobacillus sp. WCH70]
 gi|239806428|gb|ACS23493.1| Ribonucleoside-diphosphate reductase [Geobacillus sp. WCH70]
          Length = 346

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E  Q  R    +A  LEI +A
Sbjct: 206 MVATSTMINYINRDEHIHVDLFAKIFKEVLNEYPEYNTPELAQFVRETFIKAAKLEIEWA 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
           +  +     G++      Y++F AN R HQ+G + P   Y  NP  W+   E +DL K  
Sbjct: 266 NYIIGNDIDGIDMHDLSAYIKFYANVRAHQLGFDRPFDGYRTNPLRWIKAYEEVDLGK-S 324

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 325 DFFEQKSRQYTK 336


>gi|257792030|ref|YP_003182636.1| ribonucleotide-diphosphate reductase subunit beta [Eggerthella
           lenta DSM 2243]
 gi|317488666|ref|ZP_07947206.1| ribonucleotide reductase [Eggerthella sp. 1_3_56FAA]
 gi|257475927|gb|ACV56247.1| Ribonucleoside-diphosphate reductase [Eggerthella lenta DSM 2243]
 gi|316912225|gb|EFV33794.1| ribonucleotide reductase [Eggerthella sp. 1_3_56FAA]
          Length = 347

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+  E  ++ R M+ E    EI + 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFRNILLELKEEEPELFAPELVEEYRAMIKEGCEQEIRWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GLN      Y+Q++ N RC Q+G EPL++  E       W+S+  +    K
Sbjct: 267 HYAIGDDVAGLNKQMVTDYIQYLGNLRCAQLGFEPLYEGHEREPESMSWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE R T Y + + L
Sbjct: 327 TDFFEARSTAYAKSSAL 343


>gi|438946|gb|AAA60776.1| homolog of vaccinia virus CDS F4L (ribonucleotide reductase, small
           chain); putative [Variola major virus]
 gi|94484491|gb|ABF23604.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484688|gb|ABF23800.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484886|gb|ABF23997.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724274|gb|ABG43399.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 333

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 250 TVALPVKLIGMNCEMMKTYIKFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQK 316


>gi|15613065|ref|NP_241368.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus
           halodurans C-125]
 gi|14195134|sp|Q9KFH7|RIR2_BACHD RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|10173115|dbj|BAB04221.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus
           halodurans C-125]
          Length = 345

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 2/134 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE LH+    ++  ++ +E P L T+E +   +T L +A  LE  + 
Sbjct: 205 MVSTSTMINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLMKAADLEKDWF 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMSEVIDLKKEK-N 118
              +     G+N    E Y+ FIAN+R  Q+G+E P  +   NP  W+    D+   K +
Sbjct: 265 RYIIGDKIPGINPEDMETYISFIANKRAVQLGMEKPYPEIKHNPMKWIRAYEDVNSGKSD 324

Query: 119 FFETRVTEYQQGAG 132
           FFE +  +Y + + 
Sbjct: 325 FFEQKSRQYAKVSA 338


>gi|289765931|ref|ZP_06525309.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. D11]
 gi|289717486|gb|EFD81498.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. D11]
          Length = 344

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EIA+ 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSIVKEIKNDFPNFFSAE---TVYSMFKTAVEQEIAWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|113195221|ref|YP_717351.1| ribonucleotide reductase small subunit [Taterapox virus]
 gi|90660497|gb|ABD97610.1| ribonucleotide reductase small subunit [Taterapox virus]
          Length = 319

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|58260896|ref|XP_567858.1| ribonucleoside-diphosphate reductase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134116993|ref|XP_772723.1| hypothetical protein CNBK0970 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255341|gb|EAL18076.1| hypothetical protein CNBK0970 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229939|gb|AAW46341.1| ribonucleoside-diphosphate reductase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 401

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++   PH            ++ EA  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHTDFACLLFTHLR-RRPH------PDTIARIIKEAVTIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E ++  T NPF +M E+I L+ + NFF
Sbjct: 310 TDALPVSLIGMNAKLMCQYIEFVADRLLVAMGNEKIWNST-NPFDFM-EMISLQGKANFF 367

Query: 121 ETRVTEYQQG 130
           E+RV+ Y + 
Sbjct: 368 ESRVSAYSKS 377


>gi|154505112|ref|ZP_02041850.1| hypothetical protein RUMGNA_02625 [Ruminococcus gnavus ATCC 29149]
 gi|153794591|gb|EDN77011.1| hypothetical protein RUMGNA_02625 [Ruminococcus gnavus ATCC 29149]
          Length = 347

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T E  +  + ML E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNMILEMKKELPELFTPEHIEILKEMLKEGVRQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENP--FPWMSEVIDLKKEK 117
           H  +     GL      +Y+Q++ N R   +G +P++   T+ P    W+S+  +    K
Sbjct: 267 HYVIGNQIAGLTKEMITEYIQYLGNLRFTNLGFDPIYPDQTQEPDSMRWVSQYSNANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 327 TDFFEAKSTAYAKSTAL 343


>gi|885759|gb|AAA69374.1| E4L [Variola virus]
 gi|5830589|emb|CAB54628.1| E4L protein [Variola minor virus]
 gi|94483674|gb|ABF22791.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484287|gb|ABF23401.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485692|gb|ABF24799.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486095|gb|ABF25200.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486298|gb|ABF25402.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486501|gb|ABF25604.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486703|gb|ABF25805.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94486906|gb|ABF26007.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487312|gb|ABF26411.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487921|gb|ABF27017.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489931|gb|ABF29017.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724476|gb|ABG43600.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635085|gb|ABU91534.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 319

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|10432587|dbj|BAB13815.1| ribonucleotide reductase small subunit [Lentinula edodes]
          Length = 418

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE +H +F   + + ++   PH  T E       ++ EA  +E  + 
Sbjct: 275 MPGLAFSNELISRDEGMHTDFACLLFSHLR-RRPHPDTVE------RIIKEAVAIEQEFL 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + L+  T NPF +M ++I L+ + NFF
Sbjct: 328 TDALPVSLIGMNATLMCQYIEFVADRLLVALGNKKLYNST-NPFDFM-DMISLQGKTNFF 385

Query: 121 ETRVTEYQQGA 131
           E RV++Y +  
Sbjct: 386 EKRVSDYSKAG 396


>gi|149279601|ref|ZP_01885730.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter
           sp. BAL39]
 gi|149229637|gb|EDM35027.1| ribonucleoside-diphosphate reductase 1, beta subunit [Pedobacter
           sp. BAL39]
          Length = 324

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE  H  F   + + +K        K  ++    ++ +A  +E  + 
Sbjct: 185 MPGLTFSNELISRDEGSHCEFACLLYSMLK-------NKLSEEHVHGIIRDAVEIEKEFV 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R   ++G   ++  T NPF +M E+I L+ + NFF
Sbjct: 238 TDALPVALIGMNAKLMSQYIEFVADRWLQELGYTKIYHAT-NPFDFM-EMISLQGKTNFF 295

Query: 121 ETRVTEYQQGAGL 133
           E RV +YQ+   L
Sbjct: 296 EKRVGDYQKSGVL 308


>gi|303278144|ref|XP_003058365.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459525|gb|EEH56820.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 338

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       +L  K      R ++ EA  +E  + 
Sbjct: 196 MPGLTFSNELISRDEGLHRDFACLLYS-------YLQNKPDVSIVRQIVCEAVEIEKEFV 248

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     +Y++F+A+    Q+GLE  +  T NPF +M E+I L+ + NFF
Sbjct: 249 CDALPVSLVGMNKDLMSEYIEFVADHLLGQLGLEKEYN-TVNPFEFM-ELISLQGKTNFF 306

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 307 EKRVGEYQKSG 317


>gi|321263777|ref|XP_003196606.1| ribonucleoside-diphosphate reductase [Cryptococcus gattii WM276]
 gi|317463083|gb|ADV24819.1| Ribonucleoside-diphosphate reductase, putative [Cryptococcus gattii
           WM276]
          Length = 401

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 68/130 (52%), Gaps = 9/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++   PH            ++ EA  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHTDFACLLFTHLR-RRPH------PDTIARIIKEAVSIEQEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E ++  T NPF +M E+I L+ + NFF
Sbjct: 310 TDALPVSLIGMNAKLMCQYIEFVADRLLVALGNEKIWNST-NPFDFM-EMISLQGKANFF 367

Query: 121 ETRVTEYQQG 130
           E+RV+ Y + 
Sbjct: 368 ESRVSAYSKS 377


>gi|885717|gb|AAA69333.1| C8L [Variola virus]
 gi|885826|gb|AAA69439.1| C8L [Variola virus]
 gi|94483878|gb|ABF22994.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94484081|gb|ABF23196.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485084|gb|ABF24194.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485286|gb|ABF24395.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485489|gb|ABF24597.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94485894|gb|ABF25000.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487109|gb|ABF26209.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487515|gb|ABF26613.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94487716|gb|ABF26813.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488123|gb|ABF27218.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488323|gb|ABF27417.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488523|gb|ABF27616.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488724|gb|ABF27816.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94488925|gb|ABF28016.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489125|gb|ABF28215.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489324|gb|ABF28413.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489527|gb|ABF28615.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94489726|gb|ABF28813.1| ribonucleotide reductase small subunit [Variola virus]
 gi|94490135|gb|ABF29220.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724070|gb|ABG43196.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724681|gb|ABG43804.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109724885|gb|ABG44007.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725088|gb|ABG44209.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725293|gb|ABG44413.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725496|gb|ABG44615.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725700|gb|ABG44818.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109725903|gb|ABG45020.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726107|gb|ABG45223.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726310|gb|ABG45425.1| ribonucleotide reductase small subunit [Variola virus]
 gi|109726513|gb|ABG45627.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635013|gb|ABU91466.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635031|gb|ABU91483.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635049|gb|ABU91500.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635067|gb|ABU91517.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635103|gb|ABU91551.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635121|gb|ABU91568.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635139|gb|ABU91585.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635158|gb|ABU91603.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635176|gb|ABU91620.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635194|gb|ABU91637.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635212|gb|ABU91654.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635230|gb|ABU91671.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635248|gb|ABU91688.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635266|gb|ABU91705.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635284|gb|ABU91722.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635320|gb|ABU91756.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635338|gb|ABU91773.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635356|gb|ABU91790.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635374|gb|ABU91807.1| ribonucleotide reductase small subunit [Variola virus]
 gi|156635392|gb|ABU91824.1| ribonucleotide reductase small subunit [Variola virus]
 gi|157739431|gb|ABU91739.1| ribonucleotide reductase small subunit [Variola virus]
          Length = 319

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIKFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|284039889|ref|YP_003389819.1| ribonucleoside-diphosphate reductase [Spirosoma linguale DSM 74]
 gi|283819182|gb|ADB41020.1| Ribonucleoside-diphosphate reductase [Spirosoma linguale DSM 74]
          Length = 349

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 67/130 (51%), Gaps = 8/130 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K  + +   ++  A  +E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHRDFAC------MLYTDHIVNKLPESQIYDIIRNAVEIEQEFV 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA   +QY+ F+A+     +GL  ++    NPF +M ++I L+ + NFF
Sbjct: 242 ADALPVSLIGMNAELMKQYIAFVADHLLVTLGLRKMYN-VANPFDFM-DMISLQGKTNFF 299

Query: 121 ETRVTEYQQG 130
           E RV EYQ+G
Sbjct: 300 EKRVGEYQRG 309


>gi|190896518|gb|ACE96772.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++ Y  NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVY-YVANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|317472120|ref|ZP_07931452.1| ribonucleotide reductase [Anaerostipes sp. 3_2_56FAA]
 gi|316900524|gb|EFV22506.1| ribonucleotide reductase [Anaerostipes sp. 3_2_56FAA]
          Length = 347

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+  +     R M+ +    EI + 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFKNILLELKKEEPSLFHPDCINDYRRMIKKGCEQEIRWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GL     E+Y++++ N RC  +G EP++  +E       W+S+  +    K
Sbjct: 267 HYVIGDEIQGLKKEMVEEYIRYLGNLRCQNLGFEPIYPGSETEPESMSWVSQFSNANMIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + L
Sbjct: 327 TDFFEAKSTAYAKSSAL 343


>gi|317062933|ref|ZP_07927418.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           ulcerans ATCC 49185]
 gi|313688609|gb|EFS25444.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           ulcerans ATCC 49185]
          Length = 353

 Score = 66.6 bits (161), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  + I RDE  H+     ++ +I+ ENP  +  E   +  +M  +A   EI + 
Sbjct: 213 MMGTSDVIRLINRDELSHVVIFQHLLKEIRNENPDFFNDE---EIYSMFRKAVEQEINWT 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
           +  +    +G+   + EQY +++AN R   IGL+P+++ + +NP+  +++  D + E   
Sbjct: 270 NHIIGNQILGITEETTEQYTKWLANERLRSIGLKPIYEGFNKNPYKHLTKFADTEGEGNV 329

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + +  WD
Sbjct: 330 KANFFEGTVTSYNMSSSIDGWD 351


>gi|167748341|ref|ZP_02420468.1| hypothetical protein ANACAC_03085 [Anaerostipes caccae DSM 14662]
 gi|167652333|gb|EDR96462.1| hypothetical protein ANACAC_03085 [Anaerostipes caccae DSM 14662]
          Length = 358

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++ ++K E P L+  +     R M+ +    EI + 
Sbjct: 218 MPGSVQEIRYINRDENTHLWLFKNILLELKKEEPSLFHPDCINDYRRMIKKGCEQEIRWG 277

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
           H  +     GL     E+Y++++ N RC  +G EP++  +E       W+S+  +    K
Sbjct: 278 HYVIGDEIQGLKKEMVEEYIRYLGNLRCQNLGFEPIYPGSETEPESMSWVSQFSNANMIK 337

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + L
Sbjct: 338 TDFFEAKSTAYAKSSAL 354


>gi|225386408|ref|ZP_03756172.1| hypothetical protein CLOSTASPAR_00155 [Clostridium asparagiforme
           DSM 15981]
 gi|225047489|gb|EEG57735.1| hypothetical protein CLOSTASPAR_00155 [Clostridium asparagiforme
           DSM 15981]
          Length = 347

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 70/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    ++I ++K E P L++ E  +  + M+ E    EIA+ 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLLRNMILELKKEEPQLFSPETVEMLKAMVEEGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
           H  +     GL      +Y++++ N R   +G EPL++ Y E P    W+ +  +    K
Sbjct: 267 HYVIGDRISGLTREMVTEYIRYLGNLRWTSLGFEPLYEGYEEEPESMKWVGQYSNANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 327 TDFFEAKSTAYAKSTAL 343


>gi|257468678|ref|ZP_05632772.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium
           ulcerans ATCC 49185]
          Length = 348

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  + I RDE  H+     ++ +I+ ENP  +  E   +  +M  +A   EI + 
Sbjct: 208 MMGTSDVIRLINRDELSHVVIFQHLLKEIRNENPDFFNDE---EIYSMFRKAVEQEINWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
           +  +    +G+   + EQY +++AN R   IGL+P+++ + +NP+  +++  D + E   
Sbjct: 265 NHIIGNQILGITEETTEQYTKWLANERLRSIGLKPIYEGFNKNPYKHLTKFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + +  WD
Sbjct: 325 KANFFEGTVTSYNMSSSIDGWD 346


>gi|282879357|ref|ZP_06288101.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella
           buccalis ATCC 35310]
 gi|282881358|ref|ZP_06290037.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella
           timonensis CRIS 5C-B1]
 gi|281298554|gb|EFA90979.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella
           buccalis ATCC 35310]
 gi|281304764|gb|EFA96845.1| ribonucleoside-diphosphate reductase, beta subunit [Prevotella
           timonensis CRIS 5C-B1]
          Length = 347

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 70/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P ++T E  +    M+ E    EIA+ 
Sbjct: 207 MSGSAQEIRYINRDENTHLWLFRNIIKELKKEEPEMFTPEKVKVYEEMMREGVRQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GLNA     Y+ ++ N R H +G + L++  +       W+++  D    K
Sbjct: 267 QYVIGNDIQGLNAQMVTDYIHYLGNLRWHSLGFDYLYEDNQKEPEDMKWVAQYSDPNMVK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y +   ++ D
Sbjct: 327 TDFFEAKSTAYAKSTAIEDD 346


>gi|8101697|gb|AAF72618.1|AF252539_2 ribonucleotide reductase small subunit M2 [Leishmania amazonensis]
          Length = 345

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 206 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 259

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFF
Sbjct: 260 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFF 317

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 318 EKRVGEYQKAG 328


>gi|190896526|gb|ACE96776.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++ Y  NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVY-YVANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|73544537|ref|XP_848163.1| ribonucleoside-diphosphate reductase small chain [Leishmania major
           strain Friedlin]
 gi|321438516|emb|CBZ12275.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania major strain Friedlin]
          Length = 388

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFF
Sbjct: 303 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 361 EKRVGEYQKAG 371


>gi|268575178|ref|XP_002642568.1| C. briggsae CBR-RNR-2 protein [Caenorhabditis briggsae]
 gi|187023588|emb|CAP37241.1| CBR-RNR-2 protein [Caenorhabditis briggsae AF16]
          Length = 365

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  Q++   ++ +A  +E  + 
Sbjct: 228 MPGLTHSNELISRDEGLHRDFACLLYSMLQ-------NKLSQERIFEIIRDAVAIEQEFL 280

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+    ++G + L+   +NPF +M E I +  + NFF
Sbjct: 281 TEALPVDMIGMNCRLMSQYIEFVADHLLQELGCDKLYN-VKNPFDFM-ENISIDGKTNFF 338

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 339 EKRVSEYQR 347


>gi|156387375|ref|XP_001634179.1| predicted protein [Nematostella vectensis]
 gi|156221259|gb|EDO42116.1| predicted protein [Nematostella vectensis]
          Length = 384

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   +L  K  ++  R ++ +A ++E  + 
Sbjct: 247 MPGLTFSNELISRDEGLHCDFAC-------LMYKYLVNKPDEETVRGIIKDAVVIEQEFL 299

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R    +  + ++   ENPF +M E I L+ + NFF
Sbjct: 300 TSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYN-AENPFDFM-ENISLEGKTNFF 357

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 358 EKRVGEYQKSG 368


>gi|149248382|ref|XP_001528578.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
 gi|146448532|gb|EDK42920.1| ribonucleoside-diphosphate reductase small chain [Lodderomyces
           elongisporus NRRL YB-4239]
          Length = 422

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +    ++ EA  +E  + 
Sbjct: 282 MPGLTFSNELICRDEGLHTDFACLLFS-------HLENRPDPKIVEKIISEAVEIEKEFF 334

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R    +G E ++K T NPF +M E I L  + NFF
Sbjct: 335 TDALPVSLLGMNCKLMCQYVEFVADRLLVALGNEKIYKVT-NPFDFM-ENISLAGKTNFF 392

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 393 EKRVSDYQKAG 403


>gi|3914644|sp|O46310|RIR2_LEIAM RecName: Full=Ribonucleoside-diphosphate reductase small subunit;
           AltName: Full=Ribonucleotide reductase M2 subunit;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|2828563|gb|AAC08302.1| ribonucleotide reductase M2 subunit [Leishmania amazonensis]
          Length = 345

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 206 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 259

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFF
Sbjct: 260 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFF 317

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 318 EKRVGEYQKAG 328


>gi|38683666|gb|AAR26843.1| FirrV-1-A19 [Feldmannia irregularis virus a]
          Length = 342

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+      I RDE LH    + + N +K   P     +       +  +A  LE  +  E
Sbjct: 207 GLCFANSLIARDEGLHAEGSVMIYNHLKHRLPVAVVHD-------IFTDAVALEKEFIRE 259

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   +G+NA +   Y++++++    ++G   LF  T+NPF WM+ +I ++ + NFFE 
Sbjct: 260 SLPVSLIGINADTMSSYIEYVSDFWIQRLGYPKLFG-TKNPFEWMT-MIGMEGKSNFFEG 317

Query: 123 RVTEYQQGAGL 133
           RV EY +   +
Sbjct: 318 RVAEYAKAGSM 328


>gi|157953769|ref|YP_001498660.1| hypothetical protein AR158_C579R [Paramecium bursaria Chlorella
           virus AR158]
 gi|156068417|gb|ABU44124.1| hypothetical protein AR158_C579R [Paramecium bursaria Chlorella
           virus AR158]
          Length = 324

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 76/134 (56%), Gaps = 9/134 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG  + ++++ + P        +  + ++ EA   E  + 
Sbjct: 188 MPGLGLSNEFISRDEGLHQQFGELMYSKLQNKLPF-------ETVKQIITEAVENEKEFI 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G E ++  ++NPF +M E+I L+ + NFF
Sbjct: 241 CDAIPCRLIGMNSELMGQYIEFVADRIFIALGYEKVYN-SKNPFAFM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGAGLK 134
           E RV++YQ+   +K
Sbjct: 299 EKRVSDYQRPGVMK 312


>gi|159465835|ref|XP_001691128.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
 gi|158279814|gb|EDP05574.1| ribonucleoside-diphosphate reductase small chain [Chlamydomonas
           reinhardtii]
          Length = 394

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 72/137 (52%), Gaps = 12/137 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +        T+  + + + ++ EA  +E  + 
Sbjct: 255 MPGLTFSNELISRDEGLHCDFACMLFSMLN-------TRIDETRVKQIIVEAVEIEQEFC 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    QY+QF+A+R    +G    +    NPF +M E+I L+ + NFF
Sbjct: 308 TEALPVDLIGMNSRLMAQYIQFVADRLLVSLGCAKQYNVV-NPFEFM-EMISLQGKTNFF 365

Query: 121 ETRVTEYQQG---AGLK 134
           E RV +YQ+    AGL+
Sbjct: 366 EKRVGDYQKNGVMAGLQ 382


>gi|326797773|ref|YP_004315592.1| ribonucleoside-diphosphate reductase [Sphingobacterium sp. 21]
 gi|326548537|gb|ADZ76922.1| Ribonucleoside-diphosphate reductase [Sphingobacterium sp. 21]
          Length = 323

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F   + + ++ + P       +++ + ++ +A  +E  + 
Sbjct: 186 MPGLTFSNELISRDEGLHCEFACLLYSMLEAKLP-------KERVQEIIIDAVEIEKEFI 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA   +QY++F+A+R   ++G    +  T NPF +M E+I L+ + NFF
Sbjct: 239 TDALPVKLIGMNADLMKQYIEFVADRWLVELGNSKYYNAT-NPFDFM-ELISLQGKTNFF 296

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 297 EKRVGDYQKSG 307


>gi|255711354|ref|XP_002551960.1| KLTH0B03938p [Lachancea thermotolerans]
 gi|238933338|emb|CAR21522.1| KLTH0B03938p [Lachancea thermotolerans]
          Length = 403

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 261 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIIERIITEAVEIEQRYF 313

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M E I L  + NFF
Sbjct: 314 RDALPVSLLGMNADLMNQYVEFVADRLLVALGNQKFYNVT-NPFDFM-ENISLAGKTNFF 371

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 372 EKRVSDYQKAG 382


>gi|308490981|ref|XP_003107682.1| CRE-RNR-2 protein [Caenorhabditis remanei]
 gi|308250551|gb|EFO94503.1| CRE-RNR-2 protein [Caenorhabditis remanei]
          Length = 377

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  Q++   ++ +A  +E  + 
Sbjct: 240 MPGLTHSNELISRDEGLHRDFACLLYSMLQ-------NKLTQERIFEIIRDAVCIEQEFL 292

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     QY++F+A+    ++G + L+   +NPF +M E I +  + NFF
Sbjct: 293 TEALPVDMIGMNCRLMSQYIEFVADHLLAELGCDKLYN-VKNPFDFM-ENISIDGKTNFF 350

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 351 EKRVSEYQR 359


>gi|257062099|ref|YP_003139987.1| Ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 8802]
 gi|256592265|gb|ACV03152.1| Ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 8802]
          Length = 355

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + +      M   A   E  + 
Sbjct: 215 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSVDQIYD-----MFDRAVKYECQWT 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGL+PL+   KY ++P+  +    D KKE 
Sbjct: 270 NHIVGNNILGITEASTEQYTKYLANIRLRSIGLDPLYPDIKYNKSPYTHLERFSDTKKEA 329

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 330 HTKANFFEATVTSYVMSSGITGWD 353


>gi|194755279|ref|XP_001959919.1| GF11796 [Drosophila ananassae]
 gi|190621217|gb|EDV36741.1| GF11796 [Drosophila ananassae]
          Length = 393

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F + +         HL  K  +++   ++ +A  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHCDFAVLMFQ-------HLVQKPRRERIIEIIRDAVDIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G+  ++  T+NPF +M E+I L  + NFF
Sbjct: 309 TDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYN-TKNPFNFM-EMISLDGKTNFF 366

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 367 EKKVGEYQR 375


>gi|84998662|ref|XP_954052.1| ribonucleotide reductase R2 subunit or ribonucleoside-diphosphate
           reductase small chain [Theileria annulata]
 gi|65305050|emb|CAI73375.1| ribonucleotide reductase R2 subunit or ribonucleoside-diphosphate
           reductase small chain, putative [Theileria annulata]
          Length = 322

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 61/107 (57%), Gaps = 8/107 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +FG  + + +K + P       ++  + ++ EA ++E +Y 
Sbjct: 212 MPGLTFSNELIARDEGLHADFGCFIYHNLKHKLP-------EEAVQQIIKEAVVVERSYI 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWM 107
            +++P   +G+N+    QY++F+A+R    +G+ P++  T NPF WM
Sbjct: 265 CDSLPCDLIGMNSQLMTQYIEFVADRLLQSLGVRPVYNVT-NPFDWM 310


>gi|295401051|ref|ZP_06811025.1| Ribonucleoside-diphosphate reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112173|ref|YP_003990489.1| ribonucleotide reductase [Geobacillus sp. Y4.1MC1]
 gi|294976844|gb|EFG52448.1| Ribonucleoside-diphosphate reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217274|gb|ADP75878.1| ribonucleotide reductase [Geobacillus sp. Y4.1MC1]
          Length = 346

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE +H++    +  ++  E P   T E  +  +    +A  LEI +A
Sbjct: 206 MVATSTMINYINRDEHIHVDLFAKIFKEVLSEYPEYNTPELAEFVQATFTKAAELEIEWA 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
           +  +     G++      Y++F AN R HQ+G E P   Y  NP  W+   E +DL K  
Sbjct: 266 NYIIGNDIDGIDMHDLSAYIKFYANVRAHQLGFERPFAGYRTNPLRWIKAYEEVDLGK-S 324

Query: 118 NFFETRVTEYQQ 129
           +FFE +  +Y +
Sbjct: 325 DFFEQKSRQYTK 336


>gi|210631890|ref|ZP_03297102.1| hypothetical protein COLSTE_00992 [Collinsella stercoris DSM 13279]
 gi|210159815|gb|EEA90786.1| hypothetical protein COLSTE_00992 [Collinsella stercoris DSM 13279]
          Length = 352

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I +++ E P L+T E  +  R ML E    EIA+ 
Sbjct: 212 MPGSAQEIRYINRDENTHLWLFRNIILELQKEEPQLFTSENVEMLRQMLEEGVRQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL     E Y++++ N R   +G   L++ Y   P    W+S+  +    K
Sbjct: 272 RYVLGDAIPGLTGDMVEGYIKYLGNLRWSSLGFGQLYEGYRSEPEDMAWVSQYSNANMVK 331

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 332 TDFFEAKSTAYAKSTAL 348


>gi|313768143|ref|YP_004061574.1| hypothetical protein BpV1_144c [Bathycoccus sp. RCC1105 virus BpV1]
 gi|312599750|gb|ADQ91771.1| hypothetical protein BpV1_144c [Bathycoccus sp. RCC1105 virus BpV1]
          Length = 387

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 66/125 (52%), Gaps = 9/125 (7%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE +H  F +++ N +K        K  Q     ++ +A  +E  +  +
Sbjct: 256 GLCFSNELISRDEGMHQEFAVELFNMLK-------NKPSQNTIEEIIRDAVSIEKEFITD 308

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+N+    +Y++++A+R   Q+G   ++  T+NPF +M E I L  + NFFE 
Sbjct: 309 ALPCSLIGMNSGKMSEYIEYVADRLSKQVGHNKIWN-TKNPFDFM-ENISLDGKTNFFEK 366

Query: 123 RVTEY 127
           RV +Y
Sbjct: 367 RVGDY 371


>gi|218249013|ref|YP_002374384.1| Ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 8801]
 gi|218169491|gb|ACK68228.1| Ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 8801]
          Length = 344

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + +      M   A   E  + 
Sbjct: 204 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSVDQIYD-----MFDRAVKYECQWT 258

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGL+PL+   KY ++P+  +    D KKE 
Sbjct: 259 NHIVGNNILGITEASTEQYTKYLANIRLRSIGLDPLYPDIKYNKSPYTHLERFSDTKKEA 318

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 319 HTKANFFEATVTSYVMSSGITGWD 342


>gi|6322434|ref|NP_012508.1| Rnr2p [Saccharomyces cerevisiae S288c]
 gi|1172946|sp|P09938|RIR2_YEAST RecName: Full=Ribonucleoside-diphosphate reductase small chain 1;
           AltName: Full=Ribonucleotide reductase R2 subunit 1;
           AltName: Full=Ribonucleotide reductase small subunit 1
 gi|52695523|pdb|1SMQ|A Chain A, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695524|pdb|1SMQ|B Chain B, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695525|pdb|1SMQ|C Chain C, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|52695526|pdb|1SMQ|D Chain D, Structure Of The Ribonucleotide Reductase Rnr2 Homodimer
           From Saccharomyces Cerevisiae
 gi|172450|gb|AAA34988.1| ribonucleoside diphosphate reductase small subunit [Saccharomyces
           cerevisiae]
 gi|1008142|emb|CAA89317.1| RNR2 [Saccharomyces cerevisiae]
 gi|285812874|tpg|DAA08772.1| TPA: Rnr2p [Saccharomyces cerevisiae S288c]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +   +K + +P +  K        ++ EA  +E  Y
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEK--------IVTEAVEIEQRY 310

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NF
Sbjct: 311 FLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNF 368

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+  
Sbjct: 369 FEKRVSDYQKAG 380


>gi|302682638|ref|XP_003031000.1| hypothetical protein SCHCODRAFT_57055 [Schizophyllum commune H4-8]
 gi|300104692|gb|EFI96097.1| hypothetical protein SCHCODRAFT_57055 [Schizophyllum commune H4-8]
          Length = 362

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   ++  ++   PH    E       ++ EA  +E  + 
Sbjct: 226 MPGLTFSNELITRDEGMHTDFACLLLTHMR-RRPHPEVIEM------IIKEAVAIEKEFL 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M ++I L+ + NFF
Sbjct: 279 TDALPVSLIGMNADLMCQYIEFVADRLLVALGNDKVWNAT-NPFDFM-DMISLQGKTNFF 336

Query: 121 ETRVTEYQQGA 131
           E RV++Y+  A
Sbjct: 337 EKRVSDYKIAA 347


>gi|290771185|emb|CAY80753.2| Rnr2p [Saccharomyces cerevisiae EC1118]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +   +K + +P +  K        ++ EA  +E  Y
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEK--------IVTEAVEIEQRY 310

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NF
Sbjct: 311 FLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNF 368

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+  
Sbjct: 369 FEKRVSDYQKAG 380


>gi|151945057|gb|EDN63308.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae YJM789]
 gi|190409471|gb|EDV12736.1| ribonucleotide reductase subunit [Saccharomyces cerevisiae RM11-1a]
 gi|256271075|gb|EEU06176.1| Rnr2p [Saccharomyces cerevisiae JAY291]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIVEKIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|323308423|gb|EGA61668.1| Rnr2p [Saccharomyces cerevisiae FostersO]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIVEKIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|207343947|gb|EDZ71248.1| YJL026Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIVEKIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|156387377|ref|XP_001634180.1| predicted protein [Nematostella vectensis]
 gi|156221260|gb|EDO42117.1| predicted protein [Nematostella vectensis]
          Length = 341

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   +L  K  ++  R ++ +A ++E  + 
Sbjct: 204 MPGLTFSNELISRDEGLHCDFAC-------LMYKYLVNKPDEETVRGIIKDAVVIEQEFL 256

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R    +  + ++   ENPF +M E I L+ + NFF
Sbjct: 257 TSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYN-VENPFDFM-ENISLEGKTNFF 314

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 315 EKRVGEYQKSG 325


>gi|15826569|pdb|1JK0|A Chain A, Ribonucleotide Reductase Y2y4 Heterodimer
          Length = 419

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +   +K + +P +  K        ++ EA  +E  Y
Sbjct: 279 MPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEK--------IVTEAVEIEQRY 330

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NF
Sbjct: 331 FLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNF 388

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+  
Sbjct: 389 FEKRVSDYQKAG 400


>gi|323347997|gb|EGA82256.1| Rnr2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 399

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIVEKIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|321476700|gb|EFX87660.1| hypothetical protein DAPPUDRAFT_306462 [Daphnia pulex]
          Length = 378

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  +++   +++ A  +E  + 
Sbjct: 239 MPGLTFSNELISRDEGLHTDFACVMFK-------HLVNKPPKERIIEIINNAVKIEQEFL 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G   L+  +ENPF +M E I L+ + NFF
Sbjct: 292 TDALPVEMIGMNCRLMRQYIEFVADRLLLELGCTKLYN-SENPFDFM-EHISLEGKTNFF 349

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 350 EKKVGEYQKAG 360


>gi|115387427|ref|XP_001211219.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
 gi|114195303|gb|EAU37003.1| ribonucleoside-diphosphate reductase small chain [Aspergillus
           terreus NIH2624]
          Length = 401

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q    ++ EA  +E  + 
Sbjct: 255 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQVVEDIIVEAVAIEKEFL 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G    F  T NPF +M E I L  + NFF
Sbjct: 308 TDALPVALLGMNSKLMCQYIEFVADRLLVALGNNKYFHST-NPFDFM-ESISLAGKTNFF 365

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 366 EKRVGDYQKAG 376


>gi|37551487|gb|AAQ93139.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|38348909|gb|AAR17885.1| ribonucleotide reductase small subunit [Vaccinia virus]
 gi|88900660|gb|ABD57572.1| VACV040 [Vaccinia virus]
 gi|90819703|gb|ABD98513.1| VACV-DUKE-051 [Vaccinia virus]
          Length = 319

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R ++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRYIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|172448|gb|AAA34987.1| ribonucleotide reductase subunit 2 (RNR2) [Saccharomyces
           cerevisiae]
          Length = 399

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K        ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLKNKPDPAIVEKIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G +  +K  ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYK-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|307110551|gb|EFN58787.1| hypothetical protein CHLNCDRAFT_34102 [Chlorella variabilis]
          Length = 335

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H+  +  +++   ++ +A  +E  + 
Sbjct: 195 MPGLTFSNELISRDEGLHTDFACLLYR-------HIHNRLSEERVAEIVTQAVEIEKEFI 247

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G  P      NPF WM E+I L+ + NFF
Sbjct: 248 CDALPVDLIGMNSRLMGQYIEFVADRLLVALG-NPKVYNVSNPFDWM-ELISLQGKTNFF 305

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 306 EKRVGDYQKAG 316


>gi|1808636|emb|CAA64118.1| G4L protein [Cowpox virus]
          Length = 319

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 68/129 (52%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  ++++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVKSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TAALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|255658865|ref|ZP_05404274.1| ribonucleoside-diphosphate reductase, beta subunit [Mitsuokella
           multacida DSM 20544]
 gi|260849270|gb|EEX69277.1| ribonucleoside-diphosphate reductase, beta subunit [Mitsuokella
           multacida DSM 20544]
          Length = 347

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL    +++  ++ E P L+T E ++  R M+ E    EIA+ 
Sbjct: 207 MPGSVQEIRYINRDENTHLWLFRNILRDLRAEEPDLFTPEREEMMREMIREGVRQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN    E Y+ ++ N R   IGL  L++ + E P    W+S+  +    K
Sbjct: 267 KYAIGNEVEGLNEKMIEDYVHYLGNARAESIGLGTLYEGFEEEPSSMRWVSQYANPNFIK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +F E R T Y +   L
Sbjct: 327 TDFIEGRSTAYAKSTAL 343


>gi|197322443|ref|YP_002154716.1| putative ribonucleotide reductase small subunit [Feldmannia species
           virus]
 gi|197130510|gb|ACH46846.1| putative ribonucleotide reductase small subunit [Feldmannia species
           virus]
          Length = 342

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+      I RDE LH    + + N +K   P     +       +  +AT +E  +  E
Sbjct: 207 GLCFANSLIARDEGLHAEGSVMIYNHLKHRLPVAVVHD-------IFGQATTIEKEFIRE 259

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+NA +   Y+++I++    ++G   LF  ++NPF WM+ +I ++ + NFFE 
Sbjct: 260 ALPVSLIGINAGTMSTYIEYISDFWLEKLGYPKLFN-SKNPFEWMT-MIGMEGKSNFFEG 317

Query: 123 RVTEYQQGAGL 133
           RV EY +   +
Sbjct: 318 RVAEYSKAGSM 328


>gi|21492474|ref|NP_659593.1| Ribonucleotide reductase, small subunit [Sheeppox virus]
          Length = 321

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +K    +       +    ++ EA  +E  + 
Sbjct: 184 MPGLTFSNELISRDEGLHCDFACLIFKHLKYPPSN-------EIITIIIKEAVSIEKEFL 236

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++FIA+R   ++G + +F  + NPF +M E I L+ + NFF
Sbjct: 237 TNIIPVKLIGMNCDLMSQYIEFIADRLLLELGCDKVF-MSINPFDFM-ENISLEGKTNFF 294

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 295 EKRVSEYQK 303


>gi|159030376|emb|CAO91271.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 355

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I +     PH   + ++     M   A   E  + 
Sbjct: 215 MSGSADVFKMINRDELSHVRLYQKLIPEAMAIFPHSVEQIYE-----MFDSAVKHECCWT 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGLEPL+   KY ++P+  +    D KKE 
Sbjct: 270 NHIVGNDILGITEYSTEQYTKYLANIRLKAIGLEPLYREEKYNKSPYNHLERFSDTKKEG 329

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +GL  WD
Sbjct: 330 HTKANFFEATVTSYVMSSGLTGWD 353


>gi|328855581|gb|EGG04707.1| hypothetical protein MELLADRAFT_49061 [Melampsora larici-populina
           98AG31]
          Length = 385

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++   PH          + ++ +A  +E  + 
Sbjct: 236 MPGLTFSNELISRDEGLHTDFACLLFSHLE-RRPH------PDTVQAIISQAVEIEKEFL 288

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +   ENPF +M E+I L  + NFF
Sbjct: 289 SDALPCKLIGMNADLMCQYIEFVADRLLVALGNDKFYN-AENPFDFM-EMISLSGKTNFF 346

Query: 121 ETRVTEYQQGA 131
           E RV++Y +  
Sbjct: 347 EKRVSDYAKAG 357


>gi|190896550|gb|ACE96788.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+A   + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLAFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|119360103|gb|ABL66780.1| At5g40942 [Arabidopsis thaliana]
          Length = 231

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 6/108 (5%)

Query: 28  QIKIENPH----LWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFI 83
           QI IEN H    L TK  + + + ++ +A  +E  +  + +    VG+N     QY++F+
Sbjct: 103 QIAIENIHSEILLRTKFDEDRLKAIVCDAVEIEREFVCDALSCALVGMNRELMSQYIEFV 162

Query: 84  ANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQGA 131
           A+R    +G   ++  T NPF WM E+I L+ + NFFE RV EYQ+ +
Sbjct: 163 ADRLLAALGCGKVYGVT-NPFDWM-ELISLQGKTNFFEKRVGEYQKAS 208


>gi|306819883|ref|ZP_07453537.1| ribonucleotide-diphosphate reductase beta subunit [Eubacterium
           yurii subsp. margaretiae ATCC 43715]
 gi|304552130|gb|EFM40067.1| ribonucleotide-diphosphate reductase beta subunit [Eubacterium
           yurii subsp. margaretiae ATCC 43715]
          Length = 347

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     ++ ++K E  H++T+E     R M+ +    EI +A
Sbjct: 207 MPGTVQEIRYINRDENTHLWLFRSILLELKKEEAHIFTQENINLFRNMIKQGVEEEIRWA 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL+    E Y++++ N RC  +G + +++ Y + P    W+SE  D    K
Sbjct: 267 KYAIGDNIQGLSMSMIEDYLKYLGNLRCKGLGFDNIYEGYEKEPESMSWVSEYSDPNAIK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE +V+ Y +   ++ D
Sbjct: 327 TDFFEAKVSAYAKSTVIEDD 346


>gi|254303614|ref|ZP_04970972.1| ribonucleoside-diphosphate reductase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148323806|gb|EDK89056.1| ribonucleoside-diphosphate reductase [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 344

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 69/138 (50%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EIA+ 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEIAWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|39977011|ref|XP_369893.1| hypothetical protein MGG_06408 [Magnaporthe oryzae 70-15]
 gi|145016179|gb|EDK00669.1| hypothetical protein MGG_06408 [Magnaporthe oryzae 70-15]
          Length = 403

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + +    P+      ++  + ++ +A  +E  + 
Sbjct: 248 MPGLTFSNELISRDEGLHTDFACLLFSLLN-NRPN------KEVVKEIVVDAVKIEQEFL 300

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA   +QY++F+A+R    +G E +++ T NPF +M E I L  + NFF
Sbjct: 301 TEALPCALLGMNANLMKQYIEFVADRLLVALGNEKVYRAT-NPFDFM-ENISLGGKTNFF 358

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 359 EKRVGEYQKAG 369


>gi|312599293|gb|ADQ91316.1| hypothetical protein BpV2_149c [Bathycoccus sp. RCC1105 virus BpV2]
          Length = 387

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 68/127 (53%), Gaps = 9/127 (7%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE +H  F +++ N +K        K   +    ++ +A  +E  +  +
Sbjct: 256 GLCFSNELISRDEGMHQEFAVELFNMLK-------NKPSGEIIEEIIRDAVTIEKEFITD 308

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+N+    +Y++++A+R   Q+G + ++  T+NPF +M E I L  + NFFE 
Sbjct: 309 ALPCSLIGMNSSKMSEYIEYVADRLSKQVGHDKIWN-TKNPFDFM-ENISLDGKTNFFEK 366

Query: 123 RVTEYQQ 129
           RV +Y +
Sbjct: 367 RVGDYGK 373


>gi|331245491|ref|XP_003335382.1| ribonucleoside-diphosphate reductase subunit M2 [Puccinia graminis
           f. sp. tritici CRL 75-36-700-3]
 gi|309314372|gb|EFP90963.1| ribonucleoside-diphosphate reductase subunit M2 [Puccinia graminis
           f. sp. tritici CRL 75-36-700-3]
          Length = 380

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   ++   PH          + ++ +A  +E  + 
Sbjct: 231 MPGLTFSNELISRDEGLHTDFACLLFTHLE-RRPH------PDTVQAIIAQAVEIEKEFL 283

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T NPF +M E+I L  + NFF
Sbjct: 284 SDALPCKLIGMNADLMCQYIEFVADRLLVALGNEKFYNAT-NPFDFM-EMISLSGKTNFF 341

Query: 121 ETRVTEYQQGA 131
           E RV++Y +  
Sbjct: 342 EKRVSDYAKAG 352


>gi|224007863|ref|XP_002292891.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220971753|gb|EED90087.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 297

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 10/137 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +++  + P       + +   ++  A  +E  + 
Sbjct: 160 MPGLCFSNELISRDEGLHCDFACLLYSKLVNKLP-------ESRITKIITVAVEIEKEFV 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+     Y++F A+R    +G    +  T NPF WM E+I L+ + NFF
Sbjct: 213 SDALPVELIGMNSKLMCDYIEFCADRLLGALGCSKFYNAT-NPFEWM-EMISLQGKTNFF 270

Query: 121 ETRVTEY-QQGAGLKWD 136
           E RV EY + G G+  D
Sbjct: 271 EKRVGEYAKSGVGVNKD 287


>gi|304321610|ref|YP_003855253.1| ribonucleoside-diphosphate reductase subunit beta [Parvularcula
           bermudensis HTCC2503]
 gi|303300512|gb|ADM10111.1| ribonucleoside-diphosphate reductase, beta subunit [Parvularcula
           bermudensis HTCC2503]
          Length = 340

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    + + ++   E   L T                LE  + 
Sbjct: 186 MKGMGQIVTWSIRDESLHCEGMVRLFHEFARETGAL-TPAVADDIVDCCKTVVDLEDKFI 244

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     + Y++ IA+ R  Q+GL P+F    +P PW+ E+++  +  NF
Sbjct: 245 ELAFEAGEVEGMTPDDIKAYIRHIADWRLSQLGLPPVFAADNHPLPWLREILNGVEHANF 304

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 305 FEARATEYSKGA 316


>gi|255037048|ref|YP_003087669.1| Ribonucleoside-diphosphate reductase [Dyadobacter fermentans DSM
           18053]
 gi|254949804|gb|ACT94504.1| Ribonucleoside-diphosphate reductase [Dyadobacter fermentans DSM
           18053]
          Length = 331

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 69/131 (52%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH  F   +  +      H+  +  Q++   ++ +A  +E  + 
Sbjct: 189 MPGLSFSNELISRDEGLHCEFACLLYTK------HILNQLPQERVIEIMLDAVEIEKEFV 242

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+NA   +QY+++IA+    ++G    F  + NPF +M E+I L  + NFF
Sbjct: 243 SEALPVSLIGMNADLMKQYIEYIADFWLERLGCPKQFG-SANPFDFM-ELISLPGKTNFF 300

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 301 EKRVGEYQKAG 311


>gi|109287926|ref|YP_654620.1| hypothetical protein MIV048L [Invertebrate iridescent virus 3]
 gi|123878658|sp|Q197B2|RIR2_IIV3 RecName: Full=Probable ribonucleoside-diphosphate reductase small
           subunit 048L; AltName: Full=Ribonucleotide reductase
           small subunit
 gi|106073549|gb|ABF82078.1| hypothetical protein MIV048L [Aedes taeniorhynchus iridescent
           virus]
          Length = 376

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 62/125 (49%), Gaps = 2/125 (1%)

Query: 9   QYIMRDESLHLNFGIDVINQIKIEN-PHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKG 67
           Q+ + DE+ H N  +++ + + +EN  H+     + + R    +   LE  +       G
Sbjct: 245 QWSIADETHHTNSMMELFSTLVVENKSHIRLGVLEARVRDTARKIVQLEDGFIDLAFSMG 304

Query: 68  -FVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTE 126
               L A   + Y+++I NRR   +G  PL+   ENP PW+ ++++     NFFE + TE
Sbjct: 305 EMRQLTADDVKSYIRYITNRRLQTMGYLPLYSVVENPLPWVEDLLNAPSHTNFFENKPTE 364

Query: 127 YQQGA 131
           Y + +
Sbjct: 365 YAKAS 369


>gi|18640102|ref|NP_570176.1| SPV016 ribonucleotide reductase, small subunit [Swinepox virus]
 gi|18448509|gb|AAL69755.1| SPV016 ribonucleotide reductase, small subunit [Swinepox virus]
          Length = 320

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++   +++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSKEVITSIIIDAVNIEKEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R   ++G E +F    NPF +M E I L+ + NFF
Sbjct: 236 TVAIPVDLIGMNCCLMSQYIEFVADRLLTELGCEKVFN-VYNPFSFM-EYISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 294 ERRVSEYQK 302


>gi|322378346|ref|ZP_08052803.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           suis HS1]
 gi|322379688|ref|ZP_08054002.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           suis HS5]
 gi|321147887|gb|EFX42473.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           suis HS5]
 gi|321149232|gb|EFX43675.1| ribonucleotide-diphosphate reductase subunit beta [Helicobacter
           suis HS1]
          Length = 342

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL+   ++IN ++ E   L++ E   +   M  +A  LE A+ 
Sbjct: 206 MLGSAQMIRFIQRDELTHLHLFQNMINTLRKERSDLFSPELIAEVNEMFKQAVDLESAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   + L+      Y +++A+ R   +GL  L+  ++NP  W+ +  +    + NF
Sbjct: 266 AYITQGEMLDLSPQILRTYTEYLADTRLAVVGLPKLYN-SQNPIKWVDQFANFNSHRSNF 324

Query: 120 FETRVTEYQQGA 131
           FE +V+ Y +G+
Sbjct: 325 FEAKVSNYSKGS 336


>gi|297745764|emb|CBI15820.3| unnamed protein product [Vitis vinifera]
          Length = 269

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I R E LH +F   + + ++ + P  W     QK   ++HEA  +E  + 
Sbjct: 129 MPGLTFSNELISRYEGLHCDFACLLYSLLQKQLP--W-----QKVHHIVHEAMEIETQFI 181

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+ A     Y++F+ +R    +G E  +   ENPF WM E I L+   NFF
Sbjct: 182 CEALPCALIGMKATLMSHYIKFVVDRLLVALGYERKYN-VENPFDWM-EFIFLQGNANFF 239

Query: 121 ETRVTEYQQGA 131
           + R+ +YQ+ +
Sbjct: 240 QRRMGDYQKAS 250


>gi|253582918|ref|ZP_04860136.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           varium ATCC 27725]
 gi|251835124|gb|EES63667.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           varium ATCC 27725]
          Length = 348

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 73/142 (51%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  + I RDE  H+     ++ +I+ ENP  +  E   +   M  +A   EI + 
Sbjct: 208 MMGTSDIIRLINRDELSHVVIFQHLLKEIRNENPDFFNDE---EIYDMFRKAVEQEINWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
           +  +    +G+   + EQY +++AN R   IGL+P++  + +NP+  +++  D + E   
Sbjct: 265 NHIIGNQILGITEETTEQYTKWLANERLRSIGLKPIYDGFNKNPYKHLTKFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + +  WD
Sbjct: 325 KANFFEGTVTSYNMSSSIDGWD 346


>gi|225684487|gb|EEH22771.1| ribonucleoside-diphosphate reductase small chain A
           [Paracoccidioides brasiliensis Pb03]
          Length = 413

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++    H  + E  QK   ++ EA  +E  + 
Sbjct: 262 MPGLTFSNELISRDEGLHTDFACLLFSHLR----HRPSPEAVQK---IITEAVAIEQEFL 314

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L  + NFF
Sbjct: 315 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLTGKTNFF 372

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 373 EKRVGDYQKAG 383


>gi|156386903|ref|XP_001634150.1| predicted protein [Nematostella vectensis]
 gi|156221230|gb|EDO42087.1| predicted protein [Nematostella vectensis]
          Length = 384

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   +L  K  ++  R ++ +A ++E  + 
Sbjct: 247 MPGLTFSNELISRDEGLHCDFAC-------LMYKYLVNKPDEETVRGIIKDAVVIEQEFL 299

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N     QY++F+A+R    +  + ++   ENPF +M E I L+ + NF+
Sbjct: 300 TSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYN-VENPFDFM-ENISLEGKTNFY 357

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+  
Sbjct: 358 EKRVGEYQKSG 368


>gi|67921622|ref|ZP_00515140.1| Ribonucleoside-diphosphate reductase [Crocosphaera watsonii WH
           8501]
 gi|67856734|gb|EAM51975.1| Ribonucleoside-diphosphate reductase [Crocosphaera watsonii WH
           8501]
          Length = 321

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + ++     M   A   E  + 
Sbjct: 181 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSVEQIYE-----MFDMAVNYECRWT 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKK-- 115
           +  +    +G+   S E+Y +++AN R   IGLEPL+   KY+++P+  +    D KK  
Sbjct: 236 NHIVGNNILGITESSTEKYTKYLANIRLRSIGLEPLYPEPKYSKSPYTHLERFSDTKKAA 295

Query: 116 --EKNFFETRVTEYQQGAGLK-WD 136
             + NFFE  VT Y   +GL  WD
Sbjct: 296 HTKANFFEATVTSYVMSSGLTGWD 319


>gi|254796877|ref|YP_003081714.1| ribonucleoside-diphosphate reductase, beta subunit [Neorickettsia
           risticii str. Illinois]
 gi|254590113|gb|ACT69475.1| ribonucleoside-diphosphate reductase, beta subunit [Neorickettsia
           risticii str. Illinois]
          Length = 286

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 70/141 (49%), Gaps = 9/141 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTK---EFQQKSRTMLH-EATLLE 56
           M G+ +   Y +RDE+LH N    +     +EN     K   E ++    M+H E   ++
Sbjct: 142 MKGMGQIIAYSVRDETLHSNSITKLFRTFLLENDIDKLKLEAEIREICDAMVHHEDAFID 201

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
           +A+    +     GL A   ++Y+++IAN R  Q+G   +++   NP  W+  V++  + 
Sbjct: 202 LAFEMGDVE----GLKASEVKEYIRYIANLRLKQLGFSEIYEQKVNPLLWLEAVLNTVEH 257

Query: 117 KNFFETRVTEYQQGAGL-KWD 136
            NFFE + TEY + A    WD
Sbjct: 258 TNFFENKATEYSKAATKGTWD 278


>gi|223996990|ref|XP_002288168.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220975276|gb|EED93604.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 335

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 70/137 (51%), Gaps = 10/137 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +++  + P       + +   ++  A  +E  + 
Sbjct: 198 MPGLCFSNELISRDEGLHCDFACLIYSKLVNQLP-------ESRIEEIITNAVEIEKEFV 250

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F A+R    +G +  +    NPF WM E+I L+ + NFF
Sbjct: 251 SDALPVELIGMNSKLMCQYIEFCADRLLGALGCKKHYMAV-NPFEWM-EMISLQGKTNFF 308

Query: 121 ETRVTEY-QQGAGLKWD 136
           E RV EY + G G+  D
Sbjct: 309 EKRVGEYAKSGVGVNKD 325


>gi|331083185|ref|ZP_08332301.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|330404574|gb|EGG84114.1| ribonucleoside-diphosphate reductase subunit beta [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 347

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I Q+K E P L+TKE  Q  + ML E    EIA+ 
Sbjct: 207 MPGSAQEIRYINRDENTHLWLFRNMILQLKEEEPELFTKENIQALKEMLMEGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENP--FPWMSEVIDLKKEK 117
           H  +     G++     +Y++++ N R   +G + ++  Y + P    W+S   +    K
Sbjct: 267 HYVLGDDIPGISKEMITEYIKYLGNLRFTGLGFDVVYPGYEKEPESMKWVSYYSNANMVK 326

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 327 TDFFEAKSTAYAKSTAL 343


>gi|320527966|ref|ZP_08029132.1| ribonucleoside-diphosphate reductase, beta subunit [Solobacterium
           moorei F0204]
 gi|320131592|gb|EFW24156.1| ribonucleoside-diphosphate reductase, beta subunit [Solobacterium
           moorei F0204]
          Length = 349

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDES HL    +++ +++ E P L+T E  Q  R M++     EIA+ 
Sbjct: 209 MPGSVQEIRYINRDESTHLWLFRNILVELQKEEPELFTPENIQMIREMMNTGVEQEIAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENP--FPWMSEVIDLKKEK 117
           H  +     GLN      Y++++ N R   +G   L+ +Y E P    W+ +  D    K
Sbjct: 269 HYVIGDEIPGLNKQMVTDYIKYLGNTRFATLGFGNLYEEYAEEPESMKWVKQYSDANMVK 328

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE R + Y +   ++ D
Sbjct: 329 TDFFEARPSAYAKSGAIEDD 348


>gi|284929768|ref|YP_003422290.1| ribonucleotide reductase, subunit beta [cyanobacterium UCYN-A]
 gi|284810212|gb|ADB95909.1| ribonucleotide reductase, beta subunit [cyanobacterium UCYN-A]
          Length = 354

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + ++     M   A   E  + 
Sbjct: 214 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSTEQIYE-----MFDTAVNHECRWT 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGLEPL+   ++T++P+  +    D KK+ 
Sbjct: 269 NHIVGSNILGITESSTEQYTKYLANIRLRSIGLEPLYTGEEFTKSPYSHLERFSDTKKDG 328

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE+ VT Y   +G+  WD
Sbjct: 329 HTKANFFESTVTSYVMSSGVSGWD 352


>gi|313235850|emb|CBY19835.1| unnamed protein product [Oikopleura dioica]
          Length = 382

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K  Q++   ++ +A  +E  + 
Sbjct: 239 MPGVTFSNELISRDEGLHTDFAC-------LMYKHMVQKPSQEQIIAIIRDAVSIEQEFL 291

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    + Y++F+A+R   ++    ++K  ENPF +M E+I L+ + NFF
Sbjct: 292 TDALPVRLIGMNCDLMKTYIEFVADRLLVELDCPKIYK-VENPFDFM-EMISLEGKTNFF 349

Query: 121 ETRVTEYQQGA 131
           E +V+EY +  
Sbjct: 350 EKKVSEYARAG 360


>gi|156545974|ref|XP_001606963.1| PREDICTED: similar to ENSANGP00000013211 [Nasonia vitripennis]
          Length = 388

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H+  K  +++  +++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHCDFACLMFK-------HIVQKPSEERVISIIKDAVTIEQEFL 301

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G   ++  +ENPF +M E I L+ + NFF
Sbjct: 302 TDALPVEMIGMNCRLMCQYIEFVADRLLGELGCPKVYN-SENPFDFM-EHISLEGKTNFF 359

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 360 EKKVGEYQK 368


>gi|56555145|gb|AAV98100.1| RR2 protein [Shrimp white spot syndrome virus]
          Length = 328

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 66/121 (54%), Gaps = 8/121 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    ++I RDE LH +F   ++ +  ++ P       +++   ++ EA  +E  +   
Sbjct: 216 GLTSSNEFISRDEGLHRDFACMLLKKGFVDTPS------RERILEIVTEAVRIEQEFLTV 269

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
           ++P   VG+N     QY++F+A++   ++GLE  +  T NPFP+M   I L+ + NFFE 
Sbjct: 270 SLPVKLVGMNCKLMSQYIEFVADKLLVEMGLEKHYNVT-NPFPFMDN-ISLENKTNFFEK 327

Query: 123 R 123
           R
Sbjct: 328 R 328


>gi|146090952|ref|XP_001466403.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           infantum JPCM5]
 gi|321399462|emb|CBZ08664.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania infantum JPCM5]
          Length = 392

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFF
Sbjct: 307 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 365 EKKVGEYQKAG 375


>gi|209972895|ref|YP_002300342.1| gp4 [Bacillus phage SPO1]
 gi|209871215|gb|ACI90971.1| gp4 [Bacillus phage SPO1]
          Length = 346

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 1/107 (0%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG +    YI RDE  H  F   V+  +  E P L T+E       M+ EA  LEI Y+
Sbjct: 206 MVGTSTMINYIQRDEVAHAYFFSQVLRYLMAERPELHTEENVNFIYDMMQEAADLEIEYS 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWM 107
            + +     GL+    E Y++ + NRR   +GL+ ++   EN  PWM
Sbjct: 266 QKIL-HDIPGLDLEELEGYIKSLCNRRLRGVGLDDIYAGVENSMPWM 311


>gi|260589755|ref|ZP_05855668.1| ribonucleoside-diphosphate reductase, beta subunit [Blautia
           hansenii DSM 20583]
 gi|260539995|gb|EEX20564.1| ribonucleoside-diphosphate reductase, beta subunit [Blautia
           hansenii DSM 20583]
          Length = 359

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I Q+K E P L+TKE  Q  + ML E    EIA+ 
Sbjct: 219 MPGSAQEIRYINRDENTHLWLFRNMILQLKEEEPELFTKENIQALKEMLMEGVEQEIAWG 278

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF-KYTENP--FPWMSEVIDLKKEK 117
           H  +     G++     +Y++++ N R   +G + ++  Y + P    W+S   +    K
Sbjct: 279 HYVLGDDIPGISKEMITEYIKYLGNLRFTGLGFDVVYPGYEKEPESMKWVSYYSNANMVK 338

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 339 TDFFEAKSTAYAKSTAL 355


>gi|313213932|emb|CBY40745.1| unnamed protein product [Oikopleura dioica]
          Length = 418

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K  Q++   ++ +A  +E  + 
Sbjct: 275 MPGVTFSNELISRDEGLHTDFAC-------LMYKHMVQKPSQEQIIAIIRDAVSIEQEFL 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    + Y++F+A+R   ++    ++K  ENPF +M E+I L+ + NFF
Sbjct: 328 TDALPVRLIGMNCDLMKTYIEFVADRLLVELDCPKIYK-VENPFDFM-EMISLEGKTNFF 385

Query: 121 ETRVTEYQQGA 131
           E +V+EY +  
Sbjct: 386 EKKVSEYARAG 396


>gi|146090970|ref|XP_001466408.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           infantum JPCM5]
 gi|134070770|emb|CAM69127.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania infantum JPCM5]
          Length = 388

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 71/131 (54%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  ++ T+ PF +M E+I L+ + NFF
Sbjct: 303 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYRSTQ-PFDFM-EMISLQGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 361 EKKVGEYQKAG 371


>gi|67515571|ref|XP_657671.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|40746089|gb|EAA65245.1| hypothetical protein AN0067.2 [Aspergillus nidulans FGSC A4]
 gi|259489743|tpe|CBF90266.1| TPA: Ribonucleotide reductase [Source:UniProtKB/TrEMBL;Acc:Q9HEW8]
           [Aspergillus nidulans FGSC A4]
          Length = 406

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNWRPSKKVVEDIIVEAVAIEKEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L  + NFF
Sbjct: 310 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKYFNAT-NPFDFM-ESISLAGKTNFF 367

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 368 EKRVGDYQKAG 378


>gi|295670491|ref|XP_002795793.1| ribonucleotide reductase R2 subunit variant [Paracoccidioides
           brasiliensis Pb01]
 gi|226284878|gb|EEH40444.1| ribonucleotide reductase R2 subunit variant [Paracoccidioides
           brasiliensis Pb01]
          Length = 325

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++    H  + E  QK   ++ EA  +E  + 
Sbjct: 174 MPGLTFSNELISRDEGLHTDFACLLFSHLR----HRPSPEAVQK---IITEAVAIEQEFL 226

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L  + NFF
Sbjct: 227 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLTGKTNFF 284

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 285 EKRVGDYQKAG 295


>gi|119485472|ref|ZP_01619800.1| hypothetical protein L8106_10031 [Lyngbya sp. PCC 8106]
 gi|119457228|gb|EAW38354.1| hypothetical protein L8106_10031 [Lyngbya sp. PCC 8106]
          Length = 359

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I +     PH   + ++     M   A   E  + 
Sbjct: 219 MPGSADIFKMINRDELSHVRLYQKLIPEAMQTFPHSVEQIYE-----MFDTAVQHECRWT 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  + +  +G+   S EQY +++AN R   IGL+PL+   +Y+++P+  +    D KKE 
Sbjct: 274 NHIVGRNILGITETSTEQYTKYLANARLRSIGLKPLYTDPRYSKSPYTHLERFSDTKKEA 333

Query: 117 ---KNFFETRVTEYQQGAGL-KWD 136
               NFFE  VT Y   +G+  WD
Sbjct: 334 HTKANFFEASVTSYVMSSGVGGWD 357


>gi|226294144|gb|EEH49564.1| ribonucleotide reductase R2 subunit variant [Paracoccidioides
           brasiliensis Pb18]
          Length = 325

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++    H  + E  QK   ++ EA  +E  + 
Sbjct: 174 MPGLTFSNELISRDEGLHTDFACLLFSHLR----HRPSPEAVQK---IITEAVAIEQEFL 226

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L  + NFF
Sbjct: 227 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLTGKTNFF 284

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 285 EKRVGDYQKAG 295


>gi|68304258|ref|YP_249726.1| RR2 [Chrysodeixis chalcites nucleopolyhedrovirus]
 gi|67973087|gb|AAY84053.1| RR2 [Chrysodeixis chalcites nucleopolyhedrovirus]
          Length = 318

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 7/131 (5%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G+    + I RDE LH +F     N+   E   L     + K  +M  EA  +E  +   
Sbjct: 184 GLTYSNELISRDEGLHTDFACLYYNKYIPEKNKLS----KTKVLSMFVEAVDIEKDFFTN 239

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G+N+ S  +Y++F+A+R   ++G +  F  T NPF +M+  I L+ + NFFE 
Sbjct: 240 ALPVAMLGMNSQSMCEYIEFVADRLLFELGYDKHFN-TANPFEFMNN-ISLEGKTNFFEK 297

Query: 123 RVTEYQQ-GAG 132
           RV EY++ GA 
Sbjct: 298 RVGEYKRFGAA 308


>gi|297209|emb|CAA48969.1| C8L [Variola virus]
 gi|745144|prf||2015436AF C8L gene
          Length = 333

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + YM+F+A+R   ++G + ++  T NP  +M E I L+ + NFF
Sbjct: 250 TVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIYNVT-NPSDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQK 316


>gi|544843|gb|AAB29634.1| C8L product [variola virus VAR, India-1967, Peptide, 333 aa]
          Length = 333

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 197 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 249

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + YM+F+A+R   ++G + ++  T NP  +M E I L+ + NFF
Sbjct: 250 TVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIYNVT-NPSDFM-ENISLEGKTNFF 307

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 308 EKRVGEYQK 316


>gi|314055235|ref|YP_004063573.1| ribonucleoside-diphosphate reductase small subunit-possible host
           origin [Ostreococcus tauri virus 2]
 gi|313575126|emb|CBI70139.1| ribonucleoside-diphosphate reductase small subunit-possible host
           origin [Ostreococcus tauri virus 2]
          Length = 408

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F +++   ++        +   +    ++ EA  +E  + 
Sbjct: 275 MPGLCFSNELISRDEGLHQEFAVELFKTLR-------NRPTTETIHAIVKEAVEIEKGFI 327

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++++++R   Q+G+ P++   +NPF +M E I L  + NFF
Sbjct: 328 LDALPCNLIGMNSEKMSEYIEYVSDRLLKQVGVPPIWN-AKNPFDFM-ENISLDGKTNFF 385

Query: 121 ETRVTEY 127
           E RV +Y
Sbjct: 386 EKRVGDY 392


>gi|126654703|ref|ZP_01726237.1| hypothetical protein CY0110_09717 [Cyanothece sp. CCY0110]
 gi|126623438|gb|EAZ94142.1| hypothetical protein CY0110_09717 [Cyanothece sp. CCY0110]
          Length = 352

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + ++     M   A   E  + 
Sbjct: 212 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSVEQIYE-----MFDMAVNYECRWT 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S E+Y +++AN R   IGLEPL+   KY ++P+  +    D KKE 
Sbjct: 267 NHIVGNNILGITESSTEKYTKYLANIRLRSIGLEPLYPEPKYNKSPYTHLERFSDTKKEA 326

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 327 HTKANFFEATVTSYVMSSGVTGWD 350


>gi|50286273|ref|XP_445565.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49524870|emb|CAG58476.1| unnamed protein product [Candida glabrata]
          Length = 400

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K   +    ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLF-------AHLNHKPDPEVVERIVTEAVEIEQRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R     G + ++   ENPF +M E I L  + NFF
Sbjct: 312 LDALPVALLGMNAQLMNQYVEFVADRLLVAFGNKKVYN-VENPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|306478720|ref|NP_042072.2| Ribonucleoside-diphosphate reductase small chain [Variola virus]
 gi|464615|sp|P33799|RIR2_VAR67 RecName: Full=Ribonucleoside-diphosphate reductase small chain;
           AltName: Full=Ribonucleotide reductase small subunit
          Length = 319

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R+++ +A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLYPPSEETVRSIITDAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + YM+F+A+R   ++G + ++  T NP  +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYMEFVADRLISELGFKRIYNVT-NPSDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|11878241|gb|AAG40862.1| ribonucleotide reductase [Emericella nidulans]
          Length = 406

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  +E  + 
Sbjct: 257 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNWRPSKKVVEDIIVEAVAIEKEFL 309

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  F  T NPF +M E I L  + NFF
Sbjct: 310 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKEYFNAT-NPFDFM-ESISLAGKTNFF 367

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 368 EKRVGDYQKAG 378


>gi|45184688|ref|NP_982406.1| AAL136Cp [Ashbya gossypii ATCC 10895]
 gi|44980034|gb|AAS50230.1| AAL136Cp [Ashbya gossypii ATCC 10895]
          Length = 422

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K   +    ++ EA  +E  Y 
Sbjct: 280 MPGLTFSNELICRDEGLHTDFACLLF-------AHLNNKPDTEIVEKIITEAVEIEKRYF 332

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G +  +  + NPF +M E I L  + NFF
Sbjct: 333 QDAIPVALLGMNSSLMNQYVEFVADRLLVALGNKKYYNVS-NPFDFM-ENISLAGKTNFF 390

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 391 EKRVSDYQKAG 401


>gi|225561749|gb|EEH10029.1| ribonucleotide reductase M2 B [Ajellomyces capsulatus G186AR]
 gi|240275354|gb|EER38868.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H143]
 gi|325091193|gb|EGC44503.1| ribonucleoside-diphosphate reductase subunit small [Ajellomyces
           capsulatus H88]
          Length = 413

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +    ++ EA  +E  + 
Sbjct: 262 MPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPSPEAVEKIITEAVTIEQEFL 314

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L  + NFF
Sbjct: 315 SDALPVALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLAGKTNFF 372

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 373 EKRVGDYQKAG 383


>gi|172036555|ref|YP_001803056.1| ribonucleoside-diphosphate reductase beta subunit [Cyanothece sp.
           ATCC 51142]
 gi|171698009|gb|ACB50990.1| ribonucleoside-diphosphate reductase beta subunit [Cyanothece sp.
           ATCC 51142]
          Length = 352

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I + +   PH   + ++     M   A   E  + 
Sbjct: 212 MPGSADIFKMINRDELSHVRLYQKLIPEARKVFPHSVEQIYE-----MFDMAVNYECRWT 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S E+Y +++AN R   IGLEPL+   KY ++P+  +    D KKE 
Sbjct: 267 NHIVGNNILGITESSTEKYTKYLANIRLRSIGLEPLYPEPKYNKSPYTHLERFSDTKKEA 326

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 327 HTKANFFEATVTSYVMSSGVTGWD 350


>gi|15606660|ref|NP_214040.1| ribonucleotide reductase beta chain [Aquifex aeolicus VF5]
 gi|18202109|sp|O67475|RIR2_AQUAE RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit;
           Contains: RecName: Full=Aae nrdB intein; AltName:
           Full=Aae RIR2 intein
 gi|2983879|gb|AAC07431.1| ribonucleotide reductase beta chain [Aquifex aeolicus VF5]
          Length = 696

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 16  SLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPS 75
           + H+    ++IN ++ ENP L+T E ++        A   EI +         +G+N   
Sbjct: 575 NCHVTLFRNIINTLRKENPELFTPEIEKWIVEYFKYAVNEEIKWGQYVTQNQILGINDVL 634

Query: 76  CEQYMQFIANRRCHQIGLEPLF-KYTENPFPWMSEVIDLKKEK-NFFETRVTEYQQGAGL 133
            E+Y++++ N R  QIG +P++ + TENP  W+ E   +   K +FF+ +   Y +   L
Sbjct: 635 IERYIKYLGNLRITQIGFDPIYPEVTENPLKWIDEFRKINNTKTDFFQAKPQTYSKANEL 694

Query: 134 KW 135
           KW
Sbjct: 695 KW 696


>gi|155122339|gb|ABT14207.1| hypothetical protein MT325_M653L [Paramecium bursaria chlorella
           virus MT325]
          Length = 326

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG  + +  K+EN     K    + + ++ EA   E  + 
Sbjct: 190 MPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLAQVKAIVEEAVANEKEFI 242

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    QY++F+A+R    +G    +  T NPF +M E+I L+ + NFF
Sbjct: 243 CEAIPCRMIGMNSELMGQYLEFVADRIFVALGHPKQYNAT-NPFDFM-ELISLEGKSNFF 300

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 301 ERRVSEYQR 309


>gi|254572986|ref|XP_002493602.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|238033401|emb|CAY71423.1| Small subunit of the ribonucleotide-diphosphate reductase (RNR)
           complex [Pichia pastoris GS115]
 gi|328354568|emb|CCA40965.1| ribonucleoside-diphosphate reductase subunit M2 [Pichia pastoris
           CBS 7435]
          Length = 400

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  +E  Y 
Sbjct: 259 MPGLTFSNELICRDEGLHTDFACLLFS-------HLNNRASEEIVEKIITEAVEIEKRYF 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R    +G + ++    NPF +M E I L  + NFF
Sbjct: 312 TDALPVSLLGMNCSLMCQYVEFVADRLLVALGNKKVYN-VNNPFDFM-ENISLAGKTNFF 369

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 370 EKRVSDYQKAG 380


>gi|110763195|ref|XP_397443.3| PREDICTED: ribonucleoside-diphosphate reductase subunit M2 isoform
           1 [Apis mellifera]
          Length = 384

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   I ++ P        ++  +++ +A  +E  + 
Sbjct: 247 MPGLTFSNELISRDEGLHCDFACLMFKHI-VQKPSC------ERVTSIIKDAVKIEQEFL 299

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R   ++G + ++  +ENPF +M E I L+ + NFF
Sbjct: 300 TDALPVEMIGMNCKLMCQYIEFVADRLLVELGCKKIY-MSENPFDFM-EHISLEGKTNFF 357

Query: 121 ETRVTEYQQ 129
           E +V EYQ+
Sbjct: 358 EKKVGEYQK 366


>gi|261189551|ref|XP_002621186.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239591422|gb|EEQ74003.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis SLH14081]
 gi|239613047|gb|EEQ90034.1| ribonucleotide reductase small subunit RnrA [Ajellomyces
           dermatitidis ER-3]
 gi|327356917|gb|EGE85774.1| ribonucleotide reductase M2 B [Ajellomyces dermatitidis ATCC 18188]
          Length = 413

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +    ++ EA  +E  + 
Sbjct: 262 MPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPSPEAVERIITEAVTIEQEFL 314

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M   I L  + NFF
Sbjct: 315 SDALPVALLGMNAKLMCQYIEFVADRLLVALGNKKVYNST-NPFDFMDN-ISLAGKTNFF 372

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 373 EKRVGDYQKAG 383


>gi|307151334|ref|YP_003886718.1| ribonucleotide reductase [Cyanothece sp. PCC 7822]
 gi|306981562|gb|ADN13443.1| ribonucleotide reductase [Cyanothece sp. PCC 7822]
          Length = 355

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I +     PH   K ++     M   A   E  + 
Sbjct: 215 MPGSADIFKMINRDELSHVRLYQKIIAEAMQTFPHSVDKVYE-----MFDTAVHHECRWT 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGL+PL+   KY ++P+  +    D KK+ 
Sbjct: 270 NHIVGDNILGITESSTEQYTKYLANIRLKAIGLKPLYADEKYQKSPYSHLERFSDTKKDA 329

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 330 HTKANFFEATVTSYVMSSGVTGWD 353


>gi|212693366|ref|ZP_03301494.1| hypothetical protein BACDOR_02879 [Bacteroides dorei DSM 17855]
 gi|237710423|ref|ZP_04540904.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides sp.
           9_1_42FAA]
 gi|237726931|ref|ZP_04557412.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides sp.
           D4]
 gi|212664010|gb|EEB24584.1| hypothetical protein BACDOR_02879 [Bacteroides dorei DSM 17855]
 gi|229433787|gb|EEO43864.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           dorei 5_1_36/D4]
 gi|229455145|gb|EEO60866.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides sp.
           9_1_42FAA]
          Length = 349

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EI + 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPDLFTPDKVKIYEYMMREGVKQEIEWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN    E Y+Q++ N R   +G  PL  Y EN        W+S+  +   
Sbjct: 269 QYVIGDNIQGLNRKMIEDYIQYLGNLRWSSLGFGPL--YEENHKEPESMHWVSQYSNANM 326

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE + T Y +   L+ D
Sbjct: 327 VKTDFFEAKSTAYAKSTALEDD 348


>gi|155370749|ref|YP_001426283.1| hypothetical protein FR483_N651L [Paramecium bursaria Chlorella
           virus FR483]
 gi|155124069|gb|ABT15936.1| hypothetical protein FR483_N651L [Paramecium bursaria Chlorella
           virus FR483]
          Length = 348

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    ++I RDE LH  FG  + +  K+EN     K    + + ++ EA   E  + 
Sbjct: 212 MPGLGLSNEFISRDEGLHQQFGELLYS--KLEN-----KLSLAQVKAIVEEAVANEKEFI 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    QY++F+A+R    +G    +  T NPF +M E+I L+ + NFF
Sbjct: 265 CEAIPCRMIGMNSELMGQYLEFVADRIFVALGHPKQYNAT-NPFDFM-ELISLEGKSNFF 322

Query: 121 ETRVTEYQQ 129
           E RV+EYQ+
Sbjct: 323 ERRVSEYQR 331


>gi|237738278|ref|ZP_04568759.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           mortiferum ATCC 9817]
 gi|229420158|gb|EEO35205.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           mortiferum ATCC 9817]
          Length = 348

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 74/142 (52%), Gaps = 9/142 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++  + I RDE  H+     +I +++ ENP+ + +    +   M  +A   EI++ 
Sbjct: 208 MMGTSDIIRLINRDELSHVVIFQQMIKEVQNENPNFFDENIIYE---MFEKAVEQEISWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
           +  +    +G+   + E Y +++AN R   IGL+PL++ Y +NP+  +    D + E   
Sbjct: 265 NHIIGGNILGITEKTTESYTKWLANERLKSIGLQPLYEGYEKNPYKHLERFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGLK-WD 136
             NFFE  VT Y   + ++ WD
Sbjct: 325 KANFFEGTVTSYNMSSSVEGWD 346


>gi|170089003|ref|XP_001875724.1| ribonucleotide reductase, beta subunit [Laccaria bicolor S238N-H82]
 gi|164648984|gb|EDR13226.1| ribonucleotide reductase, beta subunit [Laccaria bicolor S238N-H82]
          Length = 422

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +K   PH       +  + ++ EA  +E  + 
Sbjct: 269 MPGLTFSNELISRDEGMHTDFACLLFSHLK-RRPH------PEVVKHIIVEAVKIEQEFL 321

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T NPF +M ++I L+ + NFF
Sbjct: 322 TDALPVKLIGMNADLMCQYIEFVADRLLVSLGNEKHYNKT-NPFDFM-DMISLQGKTNFF 379

Query: 121 ETRVTEYQQGA 131
           E RV++Y +  
Sbjct: 380 EKRVSDYSKAG 390


>gi|150005609|ref|YP_001300353.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           vulgatus ATCC 8482]
 gi|254884474|ref|ZP_05257184.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides sp.
           4_3_47FAA]
 gi|294778581|ref|ZP_06744003.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides
           vulgatus PC510]
 gi|319640834|ref|ZP_07995547.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides sp.
           3_1_40A]
 gi|149934033|gb|ABR40731.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides
           vulgatus ATCC 8482]
 gi|254837267|gb|EET17576.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides sp.
           4_3_47FAA]
 gi|294447530|gb|EFG16108.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides
           vulgatus PC510]
 gi|317387646|gb|EFV68512.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides sp.
           3_1_40A]
          Length = 349

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EI + 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPDLFTPDKVKIYEYMMREGVKQEIEWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN    E Y+Q++ N R   +G  PL  Y EN        W+S+  +   
Sbjct: 269 QYVIGDNIQGLNRKMIEDYIQYLGNLRWSSLGFGPL--YEENHKEPESMHWVSQYSNANM 326

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE + T Y +   L+ D
Sbjct: 327 VKTDFFEAKSTAYAKSTALEDD 348


>gi|145249942|ref|XP_001401310.1| ribonucleoside-diphosphate reductase small chain [Aspergillus niger
           CBS 513.88]
 gi|134081995|emb|CAK46680.1| unnamed protein product [Aspergillus niger]
          Length = 396

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  +Q    ++ EA  +E  + 
Sbjct: 251 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNNRPSKQVVEDIIVEAVGIEQEFL 303

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M E I L  + NFF
Sbjct: 304 TDALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYYNAT-NPFDFM-ESISLAGKTNFF 361

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 362 EKRVGDYQKAG 372


>gi|323098445|gb|ADX22683.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R ++  A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRFIITNAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|308490921|ref|XP_003107652.1| hypothetical protein CRE_13354 [Caenorhabditis remanei]
 gi|308250521|gb|EFO94473.1| hypothetical protein CRE_13354 [Caenorhabditis remanei]
          Length = 147

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 64/120 (53%), Gaps = 9/120 (7%)

Query: 10  YIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHETMPKGFV 69
           Y  RDE LH +F   + +        L  K  Q++   ++ +A  +E  +  E +P   +
Sbjct: 19  YFFRDEGLHRDFACLLYSM-------LQNKLTQERIFEIIKDAVCIEQEFLTEALPVDMI 71

Query: 70  GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFETRVTEYQQ 129
           G+N     QY++F+A+    ++G + L+   +NPF +M E I +  + NFFE RV+EYQ+
Sbjct: 72  GMNCRLMSQYIEFVADHLLAELGCDKLYN-VKNPFDFM-ENISIDGKTNFFEKRVSEYQR 129


>gi|17974949|ref|NP_536463.1| C10L [Monkeypox virus Zaire-96-I-16]
 gi|17529816|gb|AAL40494.1|AF380138_36 C10L [Monkeypox virus Zaire-96-I-16]
 gi|51342196|gb|AAU01240.1| MPXV-WRAIR030 [Monkeypox virus]
 gi|58220500|gb|AAW67788.1| MPXV-SL-030 [Monkeypox virus]
 gi|59858836|gb|AAX09131.1| MPXV-COP-030 [Monkeypox virus]
 gi|68448710|gb|AAY96833.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68448912|gb|AAY97034.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449113|gb|AAY97234.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449313|gb|AAY97433.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|68449512|gb|AAY97631.1| ribonucleotide reductase small subunit [Monkeypox virus]
 gi|300872658|gb|ADK39060.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R ++  A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRFIITNAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|154340038|ref|XP_001565976.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           braziliensis MHOM/BR/75/M2904]
 gi|134063294|emb|CAM45500.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 388

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 303 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYNATQ-PFDFM-EMISLQGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 361 EKKVGEYQKAG 371


>gi|323098642|gb|ADX22879.1| ribonucleotide reductase small subunit [Monkeypox virus]
          Length = 319

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL     ++  R ++  A  +E  + 
Sbjct: 183 MPGLTFSNELISRDEGLHCDFACLMFK-------HLLHPPSEETVRFIITNAVSIEQEFL 235

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+N    + Y++F+A+R   ++G + ++  T NPF +M E I L+ + NFF
Sbjct: 236 TVALPVKLIGMNCEMMKTYIEFVADRLISELGFKKIYNVT-NPFDFM-ENISLEGKTNFF 293

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 294 EKRVGEYQK 302


>gi|312216546|emb|CBX96496.1| similar to ribonucleoside-diphosphate reductase subunit M2
           [Leptosphaeria maculans]
          Length = 410

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +        T+  ++  + ++ EA  +E  + 
Sbjct: 254 MPGLTFSNELISRDEGMHTDFACLLFSLLN-------TRPSKESVQAIITEAVEIEKEFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G    +  T NPF +M E I L  + NFF
Sbjct: 307 SDALPCALLGMNATLMCQYIEFVADRLLLSLGNTKFYNAT-NPFDFM-ENISLAGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 365 EKRVGDYQKAG 375


>gi|330921941|ref|XP_003299625.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
 gi|311326599|gb|EFQ92269.1| hypothetical protein PTT_10664 [Pyrenophora teres f. teres 0-1]
          Length = 410

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +         +  ++  R ++ EA  +E  + 
Sbjct: 255 MPGLTFSNELISRDEGMHTDFACLLFSLLN-------NRPSKESVRAIITEAVEIEQEFL 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G   ++  T NPF +M E I L  + NFF
Sbjct: 308 SDALPCALLGMNATLMCQYIEFVADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFF 365

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 366 EKRVGDYQKAG 376


>gi|88608725|ref|YP_506404.1| ribonucleotide-diphosphate reductase subunit beta [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600894|gb|ABD46362.1| ribonucleoside-diphosphate reductase, beta subunit [Neorickettsia
           sennetsu str. Miyayama]
          Length = 322

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 9/141 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIEN---PHLWTKEFQQKSRTMLH-EATLLE 56
           M G+ +   Y +RDE+LH N    +     +EN         E ++    M+H E   ++
Sbjct: 178 MKGMGQIIAYSVRDETLHSNSITKLFRTFLLENNIDKFKLEAEIREICNAMVHHEDAFID 237

Query: 57  IAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE 116
           +A+    +     GL A   ++Y+++IAN R  Q+G   +++   NP  W+  V++  + 
Sbjct: 238 LAFEMGDVE----GLKASEVKEYIRYIANLRLKQLGFSEIYEQKVNPLLWLEAVLNTVEH 293

Query: 117 KNFFETRVTEYQQGAGL-KWD 136
            NFFE + TEY + A    WD
Sbjct: 294 TNFFENKATEYSKAATKGTWD 314


>gi|307192386|gb|EFN75622.1| Ribonucleoside-diphosphate reductase subunit M2 [Harpegnathos
           saltator]
          Length = 344

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   + I+ P        ++ +T++ +A  +E  + 
Sbjct: 202 MPGLTFSNELISRDEGLHCDFACLMFKHV-IQKPSF------ERVKTIIMDAVEIEKEFL 254

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N      Y++F+A+R    +G + ++  +ENPF +M + I L+ + NFF
Sbjct: 255 TQALPVKLIGMNCTLMCTYIEFVADRLFVALGFDKVYN-SENPFSFM-DFISLEGKTNFF 312

Query: 121 ETRVTEYQQ 129
           E +V EY++
Sbjct: 313 EKKVGEYKK 321


>gi|299472857|emb|CBN80426.1| EsV-1-128 [Ectocarpus siliculosus]
          Length = 419

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G++     I RDE LH    + +         HL  K  Q++   +   A  +E  +   
Sbjct: 284 GLSFANSLIARDEGLHATASVLIYK-------HLRNKLPQERVHEIFEHAVSVECEFISS 336

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G++  S  +Y++F+A+   +Q+G + ++    NPF WM ++I L+ + NFFE 
Sbjct: 337 ALPVALIGISEKSMTEYIKFVADYWLNQLGYDKVYN-CANPFEWM-DMISLQGKTNFFEN 394

Query: 123 RVTEYQQGAGL 133
           RV EY +   L
Sbjct: 395 RVAEYSKPGVL 405


>gi|3220181|gb|AAC23560.1| ribonucleotide reductase M2 subunit [Leishmania amazonensis]
          Length = 354

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 215 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 269 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFF 326

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 327 EKKVGEYQKAG 337


>gi|154337607|ref|XP_001565036.1| ribonucleoside-diphosphate reductase small chain [Leishmania
           braziliensis MHOM/BR/75/M2904]
 gi|134062075|emb|CAM45178.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 392

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 307 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYNATQ-PFDFM-EMISLQGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 365 EKKVGEYQKAG 375


>gi|22549454|ref|NP_689227.1| putative ribonucleotide reductase small subunit-like protein
           [Mamestra configurata NPV-B]
 gi|22476633|gb|AAM95039.1| putative ribonucleotide reductase small subunit-like protein
           [Mamestra configurata NPV-B]
          Length = 313

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F           N  +  K   +    M  EA  +E  + 
Sbjct: 179 MPGLTFSNELISRDEGMHTDFAC------LYYNTRVNEKLSYETILDMFKEAVDIEKEFF 232

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    +Y++F+A+R   Q+G +P +    NPFP+M+  I L+ + NFF
Sbjct: 233 TDALPVALLGMNADMMCEYIEFVADRLLLQLG-QPKYYNARNPFPFMNN-ISLEGKTNFF 290

Query: 121 ETRVTEYQQ-GAG 132
           E RV EY+  G G
Sbjct: 291 ERRVGEYKMFGTG 303


>gi|169860861|ref|XP_001837065.1| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
 gi|116501787|gb|EAU84682.1| ribonucleotide reductase small subunit [Coprinopsis cinerea
           okayama7#130]
          Length = 414

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +K   PH          + ++ EA  +E  + 
Sbjct: 266 MPGLTFSNELISRDEGMHTDFACLLFSHLK-RRPH------PDVVKRIITEAVAIEQEFL 318

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E ++  T NPF +M ++I L+ + NFF
Sbjct: 319 TDALPVKLIGMNAELMCQYIEFVADRLLVSLGNEKVYNST-NPFDFM-DMISLQGKTNFF 376

Query: 121 ETRVTEYQQGA 131
           E RV++Y +  
Sbjct: 377 EKRVSDYAKAG 387


>gi|168015485|ref|XP_001760281.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688661|gb|EDQ75037.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 330

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +         K  + +   ++ EA ++E  + 
Sbjct: 188 MPGLTFSNELISRDEGLHCDFACLLYTLLN-------NKLSEDRVYEIVCEAVVIEQEFV 240

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    VG+N     +Y+ F+A+R    +G    +  + NPF WM E+I L+ + NFF
Sbjct: 241 CEALSCDLVGMNKTLMSEYIDFVADRLLVSLGYPKKYN-SHNPFDWM-ELISLQGKTNFF 298

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 299 EKRVGEYQKAS 309


>gi|215401283|ref|YP_002332587.1| ribonucleotide reductase small subunit [Helicoverpa armigera
           multiple nucleopolyhedrovirus]
 gi|198448783|gb|ACH88573.1| ribonucleotide reductase small subunit [Helicoverpa armigera
           multiple nucleopolyhedrovirus]
          Length = 313

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F           N  +  K   +    M  EA  +E  + 
Sbjct: 179 MPGLTFSNELISRDEGMHTDFAC------LYYNTRVNEKLSYETILDMFKEAVDIEKEFF 232

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    +Y++F+A+R   Q+G +P +    NPFP+M+  I L+ + NFF
Sbjct: 233 TDALPVALLGMNADMMCEYIEFVADRLLLQLG-QPKYYNARNPFPFMNN-ISLEGKTNFF 290

Query: 121 ETRVTEYQQ-GAG 132
           E RV EY+  G G
Sbjct: 291 ERRVGEYKMFGTG 303


>gi|19703451|ref|NP_603013.1| ribonucleoside-diphosphate reductase beta chain [Fusobacterium
           nucleatum subsp. nucleatum ATCC 25586]
 gi|19713529|gb|AAL94312.1| Ribonucleoside-diphosphate reductase beta chain [Fusobacterium
           nucleatum subsp. nucleatum ATCC 25586]
          Length = 348

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 208 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 265 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 325 KSNFFEGTVTSYNMSSSI 342


>gi|296329016|ref|ZP_06871523.1| ribonucleotide-diphosphate reductase beta subunit [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
 gi|296153909|gb|EFG94720.1| ribonucleotide-diphosphate reductase beta subunit [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
          Length = 348

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 208 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 265 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 325 KSNFFEGTVTSYNMSSSI 342


>gi|68481406|ref|XP_715342.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|68481537|ref|XP_715277.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436893|gb|EAK96248.1| hypothetical protein CaO19.13223 [Candida albicans SC5314]
 gi|46436961|gb|EAK96315.1| hypothetical protein CaO19.5801 [Candida albicans SC5314]
 gi|238882096|gb|EEQ45734.1| ribonucleoside-diphosphate reductase small chain 1 [Candida
           albicans WO-1]
          Length = 413

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  +   +    ++ EA  +E  Y 
Sbjct: 273 MPGLTFSNELICRDEGLHTDFACLLF-------AHLQNRPSPEIVERIITEAVDVEKEYF 325

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R    +G + ++  T NPF +M E I L  + NFF
Sbjct: 326 TDALPVSLLGMNCNLMCQYIEFVADRLLLALGNKKVYNVT-NPFDFM-ENISLAGKTNFF 383

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 384 EKRVSDYQKAG 394


>gi|241951066|ref|XP_002418255.1| ribonucleoside-diphosphate reductase small chain 1, putative;
           ribonucleotide reductase r2 subunit 1, putative;
           ribonucleotide reductase small subunit 1, putative
           [Candida dubliniensis CD36]
 gi|223641594|emb|CAX43555.1| ribonucleoside-diphosphate reductase small chain 1, putative
           [Candida dubliniensis CD36]
          Length = 413

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  +   +    ++ EA  +E  Y 
Sbjct: 273 MPGLTFSNELICRDEGLHTDFACLLF-------AHLQNRPSPEIVEKIITEAVDVEKEYF 325

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N     QY++F+A+R    +G + ++  T NPF +M E I L  + NFF
Sbjct: 326 TDALPVSLLGMNCNLMCQYIEFVADRLLLALGNKKVYNVT-NPFDFM-ENISLAGKTNFF 383

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 384 EKRVSDYQKAG 394


>gi|190896546|gb|ACE96786.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|294784669|ref|ZP_06749957.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_27]
 gi|294486383|gb|EFG33745.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_27]
          Length = 344

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|256846215|ref|ZP_05551673.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_36A2]
 gi|256719774|gb|EEU33329.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           sp. 3_1_36A2]
          Length = 344

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|237743586|ref|ZP_04574067.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 7_1]
 gi|229432617|gb|EEO42829.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 7_1]
          Length = 344

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPLF  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLFSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|190896532|gb|ACE96779.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896554|gb|ACE96790.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|219126374|ref|XP_002183434.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405190|gb|EEC45134.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 296

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 70/135 (51%), Gaps = 10/135 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + ++++ + P     E       ++ +A  +E  + 
Sbjct: 160 MPGLCFSNELISRDEGLHCDFACLLYSKLQNQLPVARIVE-------IITDAVTIEQEFV 212

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++F A+R    +G    +K   NPF WM E+I L+ + NFF
Sbjct: 213 QDALPVELIGMNSTLMCRYIEFCADRLLVALGCPKHYKAV-NPFDWM-EMISLQGKTNFF 270

Query: 121 ETRVTEY-QQGAGLK 134
           E RV EY + G G K
Sbjct: 271 EKRVGEYAKSGVGEK 285


>gi|190896508|gb|ACE96767.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896514|gb|ACE96770.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896522|gb|ACE96774.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896540|gb|ACE96783.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896542|gb|ACE96784.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896520|gb|ACE96773.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|322493026|emb|CBZ28311.1| ribonucleoside-diphosphate reductase small chain,putative
           [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 388

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 249 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 302

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 303 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFF 360

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 361 EKKVGEYQKAG 371


>gi|322491821|emb|CBZ27094.1| ribonucleoside-diphosphate reductase small chain,putative
           [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 392

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 307 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYNSTQ-PFDFM-EMISLQGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 365 EKKVGEYQKAG 375


>gi|190896564|gb|ACE96795.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896516|gb|ACE96771.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896510|gb|ACE96768.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896556|gb|ACE96791.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896562|gb|ACE96794.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896538|gb|ACE96782.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896548|gb|ACE96787.1| ribonucleotide reductase beta subunit [Populus tremula]
 gi|190896558|gb|ACE96792.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|190896552|gb|ACE96789.1| ribonucleotide reductase beta subunit [Populus tremula]
          Length = 223

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++        K  +++ + ++ +A  +E  + 
Sbjct: 106 MPGLTFSNELISRDEGLHCDFACLLYSLLR-------KKLSEERVKGIVKDAVDIEREFV 158

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   VG+N     QY++F+A+R    +G   ++    NPF  M E+I L+ + NFF
Sbjct: 159 VDALPCALVGMNGELMSQYIEFVADRLLGALGCGKVYN-VANPFDGM-ELISLQGKTNFF 216

Query: 121 ETRVTEY 127
           E RV EY
Sbjct: 217 EKRVGEY 223


>gi|189199548|ref|XP_001936111.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187983210|gb|EDU48698.1| ribonucleoside-diphosphate reductase subunit M2 [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 410

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +         +   ++ R ++ EA  +E  + 
Sbjct: 255 MPGLTFSNELISRDEGMHTDFACLLFSLLN-------NRPSNEEVRAIITEAVEIEQEFL 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G   ++  T NPF +M E I L  + NFF
Sbjct: 308 SDALPCALLGMNATLMCQYIEFVADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFF 365

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 366 EKRVGDYQKAG 376


>gi|150863757|ref|XP_001382334.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
 gi|149385013|gb|ABN64305.2| small subunit of ribonucleotide reductase [Scheffersomyces stipitis
           CBS 6054]
          Length = 417

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +    ++ EA  +E  + 
Sbjct: 274 MPGLTFSNELICRDEGLHTDFACLLFS-------HLQNRPDAEIVEKIITEAVKIEKEFF 326

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G + ++  T NPF +M E I L  + NFF
Sbjct: 327 TDALPSSLLGMNAELMCQYVEFVADRLLVALGNKKVYNVT-NPFDFM-ENISLAGKTNFF 384

Query: 121 ETRVTEYQQGA 131
           E RV++YQ+  
Sbjct: 385 EKRVSDYQKAG 395


>gi|313768358|ref|YP_004062038.1| hypothetical protein MpV1_155c [Micromonas sp. RCC1109 virus MpV1]
 gi|312599054|gb|ADQ91078.1| hypothetical protein MpV1_155c [Micromonas sp. RCC1109 virus MpV1]
          Length = 388

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 68/127 (53%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F +++   ++        K   +   +++ EA  +E  + 
Sbjct: 255 MPGLCFSNELISRDEGLHQEFAVELFKLLR-------NKPSTETIHSIVKEAVEIEKNFI 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++++++R   Q+G  P++  ++NPF +M E I L  + NFF
Sbjct: 308 LDALPCNLIGMNSEKMSEYIEYVSDRLLKQVGQPPIWN-SKNPFDFM-ENISLDGKTNFF 365

Query: 121 ETRVTEY 127
           E RV +Y
Sbjct: 366 EKRVGDY 372


>gi|265756566|ref|ZP_06090772.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides sp.
           3_1_33FAA]
 gi|263233754|gb|EEZ19369.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides sp.
           3_1_33FAA]
          Length = 349

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EI + 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPDLFTPDKVKIYEYMMREGVKQEIEWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN    E Y+Q++ N R   +G  PL  Y EN        W+S+  +   
Sbjct: 269 QYVIGDNIQGLNWKMIEDYIQYLGNLRWSSLGFGPL--YEENHKEPESMHWVSQYSNANM 326

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE + T Y +   L+ D
Sbjct: 327 VKTDFFEAKSTAYAKSTALEDD 348


>gi|225434341|ref|XP_002276454.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 841

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I R E LH +F   + + ++ + P  W     QK   ++HEA  +E  + 
Sbjct: 701 MPGLTFSNELISRYEGLHCDFACLLYSLLQKQLP--W-----QKVHHIVHEAMEIETQFI 753

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+ A     Y++F+ +R    +G E  +   ENPF WM E I L+   NFF
Sbjct: 754 CEALPCALIGMKATLMSHYIKFVVDRLLVALGYERKYN-VENPFDWM-EFIFLQGNANFF 811

Query: 121 ETRVTEYQQGA 131
           + R+ +YQ+ +
Sbjct: 812 QRRMGDYQKAS 822


>gi|22788780|ref|NP_690492.1| Rr2 [Heliothis zea virus 1]
 gi|22671540|gb|AAN04367.1|AF451898_72 Rr2 [Heliothis zea virus 1]
          Length = 333

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 76/135 (56%), Gaps = 9/135 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVI-NQIKIENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    ++I RDE LH +F I +  N ++ E      +   +K   ++ +A  +E  +
Sbjct: 193 MPGLTHSNEFISRDEGLHCDFAILLFRNYLRPE-----CRSSDEKVINIVTDAVRIEQEF 247

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             E++P   +G+N     +Y++F+A+R  +++    ++   +NPF +M+  I L+ + NF
Sbjct: 248 LTESLPVSMIGMNCKLMCEYIEFVADRLLYELIGRKIYN-AKNPFDFMTS-ISLEGKTNF 305

Query: 120 FETRVTEYQQ-GAGL 133
           FE +V+EY++ G G+
Sbjct: 306 FEKKVSEYKRYGVGV 320


>gi|313887688|ref|ZP_07821370.1| ribonucleoside-diphosphate reductase, beta subunit [Peptoniphilus
           harei ACS-146-V-Sch2b]
 gi|312846297|gb|EFR33676.1| ribonucleoside-diphosphate reductase, beta subunit [Peptoniphilus
           harei ACS-146-V-Sch2b]
          Length = 346

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G   + +YI RDE+ HL     +I ++K E P ++T E  +K + ML +    EIA+ 
Sbjct: 206 MPGTVSEIRYINRDENTHLWLFRSIILEMKKEEPEIFTDENIEKYKEMLKKGVEEEIAWG 265

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN    E Y+ ++ N R   +G   LF   EN        W+SE  D  +
Sbjct: 266 KYVIGDEIKGLNEKMIEDYIMYLGNLRSRNLGFGNLF--DENIDEPESMKWVSEYSDPNQ 323

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE R + Y + + ++ D
Sbjct: 324 IKTDFFEARPSAYSKSSVIEDD 345


>gi|302843870|ref|XP_002953476.1| hypothetical protein VOLCADRAFT_109884 [Volvox carteri f.
           nagariensis]
 gi|300261235|gb|EFJ45449.1| hypothetical protein VOLCADRAFT_109884 [Volvox carteri f.
           nagariensis]
          Length = 400

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 74/138 (53%), Gaps = 14/138 (10%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQ-KSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +   +        +K+ ++ + + ++ EA  +E  +
Sbjct: 261 MPGLTFSNELISRDEGLHCDFACLLYGML--------SKQLEESRIKEIICEAVDIENEF 312

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+N+    QY++F+A+R    +G    +  T NPF +M ++I L+ + NF
Sbjct: 313 CTDALPVDLIGMNSRLMAQYIEFVADRLLVALGCSKAYNVT-NPFDFM-DMISLQGKTNF 370

Query: 120 FETRVTEYQQG---AGLK 134
           FE RV +YQ+    AGL+
Sbjct: 371 FEKRVGDYQKSGVMAGLQ 388


>gi|222824493|ref|YP_002576067.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           lari RM2100]
 gi|222539714|gb|ACM64815.1| ribonucleoside-diphosphate reductase, beta subunit [Campylobacter
           lari RM2100]
          Length = 340

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G A+  ++I RDE  HL    ++IN ++ E   L+      K   M  +A  LEI + 
Sbjct: 204 MLGSAQMIRFIQRDEITHLLLFQNMINSVRKERADLFNDTNVSKIYDMFKKAGELEIKWG 263

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK-NF 119
                   +G      E+Y+ ++ ++R   I L+ ++   ++P  W+ +      +K NF
Sbjct: 264 KYITQNQIMGFTDDIIEEYIHYLVDQRLIAINLDKIYN-VKHPIKWVDDFSKFNDQKSNF 322

Query: 120 FETRVTEYQQGA 131
           FE++VT Y +G+
Sbjct: 323 FESKVTNYSKGS 334


>gi|169613737|ref|XP_001800285.1| hypothetical protein SNOG_10001 [Phaeosphaeria nodorum SN15]
 gi|111061216|gb|EAT82336.1| hypothetical protein SNOG_10001 [Phaeosphaeria nodorum SN15]
          Length = 409

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F   + + +        T+  +   + ++ EA  +E  + 
Sbjct: 255 MPGLTFSNELISRDEGMHTDFACLLFSLLN-------TRPSKDAVKAIITEAVEIEQEFL 307

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    QY++F+A+R    +G   ++  T NPF +M E I L  + NFF
Sbjct: 308 TEALPCALLGMNSTLMCQYIEFVADRLLLALGNTKVYNAT-NPFDFM-ENISLAGKTNFF 365

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 366 EKRVGDYQKAG 376


>gi|300706309|ref|XP_002995432.1| hypothetical protein NCER_101672 [Nosema ceranae BRL01]
 gi|239604534|gb|EEQ81761.1| hypothetical protein NCER_101672 [Nosema ceranae BRL01]
          Length = 325

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 70/131 (53%), Gaps = 13/131 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKI-ENPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   ++NQ  I ++PH+           ++ EA  +E  +
Sbjct: 190 MPGLTFSNELISRDEGLHCDFAC-LLNQYLINKSPHI---------LDIVKEAVEIEKEF 239

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
              ++P   +G+N     QY++F+A+R    +GLE  +  T NPF +M E I L  + NF
Sbjct: 240 LGVSLPVNLIGMNCKLMCQYIEFVADRLLINLGLEKYYN-TLNPFDFM-ENISLVGKTNF 297

Query: 120 FETRVTEYQQG 130
           F+ R ++YQ+ 
Sbjct: 298 FDKRESQYQKA 308


>gi|227871657|ref|ZP_03990072.1| ribonucleoside-diphosphate reductase [Oribacterium sinus F0268]
 gi|227842499|gb|EEJ52714.1| ribonucleoside-diphosphate reductase [Oribacterium sinus F0268]
          Length = 347

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL F  +++ ++K E P L+ +    +   M+ +    EIA+ 
Sbjct: 207 MPGSVQEIRYINRDENTHLWFFRNMLLELKKEEPELFDEAHIAEITEMVKKGVEQEIAWG 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GLN    E Y++++ N R   +GL  L++ Y + P    W+S+  D    K
Sbjct: 267 QYVIGDSIPGLNGKMVEDYIRYLGNLRYRSLGLPNLYEGYEKEPESMKWVSQYADANMVK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE R T Y +   ++ D
Sbjct: 327 TDFFEARSTAYAKSTAIEDD 346


>gi|322795965|gb|EFZ18591.1| hypothetical protein SINV_11129 [Solenopsis invicta]
          Length = 426

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   I I+ P        +  ++++ +A  +E  + 
Sbjct: 284 MPGLTFSNELISRDEGLHCDFACLIFKHI-IQKPSF------EHVKSIIMDAVEIEKEFL 336

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N      Y++F+A+R    +G E ++  +ENPF +M+  I L+ + NFF
Sbjct: 337 TQALPVELIGMNCSLMCNYIEFVADRLFVALGFEKVYN-SENPFSFMN-FISLEGKTNFF 394

Query: 121 ETRVTEYQQ 129
           E +V EY++
Sbjct: 395 EKKVGEYKK 403


>gi|297587320|ref|ZP_06945965.1| ribonucleotide-diphosphate reductase beta subunit [Finegoldia magna
           ATCC 53516]
 gi|297575301|gb|EFH94020.1| ribonucleotide-diphosphate reductase beta subunit [Finegoldia magna
           ATCC 53516]
          Length = 354

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I  +K E P L+T+E   + + M+ + +  EI +A
Sbjct: 214 MPGTVQEIRYINRDENTHLWLFRSMILDLKKERPELFTEEKNAQYKEMIKQGSEAEIEWA 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP---WMSEVIDLKKEK 117
              + +   GL+    E Y++++ N R   +G   ++   E   P   W+SE  D  K K
Sbjct: 274 KYVIGEKIQGLSIKMVEDYIKYLGNLRSTGLGFGVIYPGYEREIPSMKWVSEYSDPNKIK 333

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + + Y + A ++ D
Sbjct: 334 TDFFEAKPSAYSKSAIIEDD 353


>gi|328700093|ref|XP_001944536.2| PREDICTED: ribonucleoside-diphosphate reductase subunit M2-like
           [Acyrthosiphon pisum]
          Length = 361

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         HL  K  Q     ++ EA  +E  + 
Sbjct: 221 MPGLTFSNELISRDEGLHTDFACLLFK-------HLEQKPPQAVITHIICEAVTIEQDFL 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   VG++      Y++F+A+R  +++G   +++ + NPFP+M ++I  + + NFF
Sbjct: 274 TNALPVRMVGMSCEKMAVYIEFVADRLLNELGCPTVYR-SSNPFPFM-DLISQQGKTNFF 331

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+ +
Sbjct: 332 EKRVGDYQKAS 342


>gi|15639047|ref|NP_218493.1| ribonucleotide-diphosphate reductase subunit beta [Treponema
           pallidum subsp. pallidum str. Nichols]
 gi|189025287|ref|YP_001933059.1| ribonucleotide-diphosphate reductase subunit beta [Treponema
           pallidum subsp. pallidum SS14]
 gi|6093976|sp|O83092|RIR2_TREPA RecName: Full=Ribonucleoside-diphosphate reductase subunit beta;
           AltName: Full=Ribonucleotide reductase small subunit
 gi|3322311|gb|AAC65049.1| ribonucleoside-diphosphate reductase, subunit beta (nrdB)
           [Treponema pallidum subsp. pallidum str. Nichols]
 gi|189017862|gb|ACD70480.1| ribonucleoside-diphosphate reductase, subunit beta [Treponema
           pallidum subsp. pallidum SS14]
 gi|291059468|gb|ADD72203.1| ribonucleoside-diphosphate reductase, beta subunit [Treponema
           pallidum subsp. pallidum str. Chicago]
          Length = 351

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 66/137 (48%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I +++ E P ++T    +  R M+ E    EI + 
Sbjct: 211 MPGSVQEIRYINRDENTHLWLFRSIIQELQKEEPQVFTARNVRLFRDMIREGCEQEIKWG 270

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKEK 117
              +     GLN      Y++++ N RC  +G EPL+   +       W+S+  +    K
Sbjct: 271 DYVIGDQIPGLNRHMVADYIRYLGNLRCENLGFEPLYEGHRVEPESMSWVSQYSNANLIK 330

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y + + +
Sbjct: 331 TDFFEAKSTAYAKSSAM 347


>gi|51869996|ref|YP_073549.1| Ribonucleotide reductase [Lymphocystis disease virus - isolate
           China]
 gi|51858204|gb|AAU10888.1| Ribonucleotide reductase [Lymphocystis disease virus - isolate
           China]
          Length = 374

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 3/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +  ++ +RDE++H+     +   I  E P + TK+F +   T+  E   LE A+ 
Sbjct: 239 MKGMGKVVEWSIRDENVHVEGLCKLFKTIVSEYPFILTKDFYKAVETLQQEVLKLETAFV 298

Query: 61  HET-MPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
               +      L       Y+++I  RR  Q+GL       +NP  W+S +I  +   NF
Sbjct: 299 DLVFIEDKLKNLKRVDVINYVKYILQRRTVQLGLSNKTDL-QNPILWVSWLISGRDVTNF 357

Query: 120 FETRVTEYQQGAGLKWD 136
           FE RVTEY  G GL+ D
Sbjct: 358 FENRVTEYDVG-GLEGD 373


>gi|158430770|pdb|2RCC|A Chain A, Crystal Structure Of Putative Class I Ribonucleotide
           Reductase (Np_241368.1) From Bacillus Halodurans At 1.90
           A Resolution
 gi|158430771|pdb|2RCC|B Chain B, Crystal Structure Of Putative Class I Ribonucleotide
           Reductase (Np_241368.1) From Bacillus Halodurans At 1.90
           A Resolution
 gi|158430772|pdb|2RCC|C Chain C, Crystal Structure Of Putative Class I Ribonucleotide
           Reductase (Np_241368.1) From Bacillus Halodurans At 1.90
           A Resolution
          Length = 346

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 2/133 (1%)

Query: 2   VGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAH 61
           V  +    YI RDE LH+    ++  ++ +E P L T+E +   +T L +A  LE  +  
Sbjct: 207 VSTSTXINYINRDEQLHVYLFTNIFKELLVEFPELNTEETKTFVKTTLXKAADLEKDWFR 266

Query: 62  ETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMSEVIDLKKEK-NF 119
             +     G+N    E Y+ FIAN+R  Q+G E P  +   NP  W+    D+   K +F
Sbjct: 267 YIIGDKIPGINPEDXETYISFIANKRAVQLGXEKPYPEIKHNPXKWIRAYEDVNSGKSDF 326

Query: 120 FETRVTEYQQGAG 132
           FE +  +Y + + 
Sbjct: 327 FEQKSRQYAKVSA 339


>gi|20069937|ref|NP_613141.1| ribonucleotide reductase small subunit [Mamestra configurata NPV-A]
 gi|20043331|gb|AAM09166.1| ribonucleotide reductase small subunit [Mamestra configurata NPV-A]
 gi|33331769|gb|AAQ11077.1| putative ribonucleotide reductase small subunit-like protein
           [Mamestra configurata NPV-A]
          Length = 313

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 67/133 (50%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE +H +F           N  +  K   +K   M  EA  +E  + 
Sbjct: 179 MPGLTFSNELISRDEGMHTDFAC------LYYNTRVKEKLSYEKILDMFKEAVDIEKEFF 232

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    +Y++F+A+R   Q+G +P +    NPF +M+  I L+ + NFF
Sbjct: 233 TDALPVSLLGMNATMMCEYIEFVADRLLMQLG-QPKYYNARNPFSFMNN-ISLEGKTNFF 290

Query: 121 ETRVTEYQQ-GAG 132
           E RV EY+  G G
Sbjct: 291 ERRVGEYKMFGTG 303


>gi|83859670|ref|ZP_00953190.1| ribonucleotide-diphosphate reductase beta subunit [Oceanicaulis
           alexandrii HTCC2633]
 gi|83852029|gb|EAP89883.1| ribonucleotide-diphosphate reductase beta subunit [Oceanicaulis
           alexandrii HTCC2633]
          Length = 348

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 64/132 (48%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    + + +    E   L TK  +            LE  + 
Sbjct: 186 MKGMGQIVSWSVRDESLHCEGMMKLFHTFAEETGAL-TKGVKDDIADCCKTVVSLEDKFI 244

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G V G+     + Y+++IA+ R  Q+ L  ++   E+P PW++E+++  +  NF
Sbjct: 245 ELAFEAGEVEGMTPEDIKNYIRYIADWRMKQLKLPTIYGVEEHPIPWLTEILNGVEHANF 304

Query: 120 FETRVTEYQQGA 131
           FE R TEY +GA
Sbjct: 305 FEARATEYSKGA 316


>gi|167648664|ref|YP_001686327.1| ribonucleotide-diphosphate reductase subunit beta [Caulobacter sp.
           K31]
 gi|167351094|gb|ABZ73829.1| Ribonucleoside-diphosphate reductase [Caulobacter sp. K31]
          Length = 346

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH    I + +    E   + T E             ++E A+ 
Sbjct: 186 MKGMGQIVSWSIRDESLHCEGIIKLYHAFNAETKCV-TPEVAADIVECCKSVVIMEDAFI 244

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + G+     +QY++FIA+ R  Q+ L  ++   ENP PW+  ++   +  NF
Sbjct: 245 DLAFEAGEIQGMTPHDIKQYIRFIADWRLRQLHLPEVYGIKENPLPWLQSLLSGVEHANF 304

Query: 120 FETRVTEYQQGA 131
           FE R TEY + A
Sbjct: 305 FEARATEYSKAA 316


>gi|229816571|ref|ZP_04446870.1| hypothetical protein COLINT_03629 [Collinsella intestinalis DSM
           13280]
 gi|229807906|gb|EEP43709.1| hypothetical protein COLINT_03629 [Collinsella intestinalis DSM
           13280]
          Length = 352

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 66/137 (48%), Gaps = 4/137 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL     +I +++ E P L++ E     R ML E    EIA+ 
Sbjct: 212 MPGSAQEIRYINRDENTHLWLFRSIILELQKEEPQLFSNENVTMLREMLEEGVRQEIAWG 271

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENP--FPWMSEVIDLKKEK 117
              +     GL     E Y++++ N R   +G   L++ Y   P    W+S+  +    K
Sbjct: 272 RYVLGDAIPGLTGDMVEGYIKYLGNLRWSSLGFGQLYEGYRTEPADMAWVSQYSNANMVK 331

Query: 118 -NFFETRVTEYQQGAGL 133
            +FFE + T Y +   L
Sbjct: 332 TDFFEAKSTAYAKSTAL 348


>gi|320164906|gb|EFW41805.1| ribonucleotide reductase m2 polypeptide [Capsaspora owczarzaki ATCC
           30864]
          Length = 352

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +         +        ++ +A  +E  + 
Sbjct: 215 MPGLTFSNELISRDEGLHCDFACMLFGLLN-------NRPSNADVLAIIKDAVAIEQEFL 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N    + Y++F+A+R    +G E  +K  ENPF +M ++I L+ + NFF
Sbjct: 268 TDALPVALIGMNGGLMKTYIEFVADRLLVALGQEKHYK-VENPFDFM-DLISLQGKTNFF 325

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 326 ERRVGEYQK 334


>gi|149182583|ref|ZP_01861054.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           SG-1]
 gi|148849719|gb|EDL63898.1| ribonucleoside-diphosphate reductase beta subunit [Bacillus sp.
           SG-1]
          Length = 345

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 63/134 (47%), Gaps = 4/134 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MV  +    YI RDE LH+     +  ++  ENP   T E +         A  LEI + 
Sbjct: 205 MVATSTMINYINRDEQLHVGLFEKIYKEVLHENPEYDTAELKVFGTQAFKRAAELEIEWG 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE-PLFKYTENPFPWMS--EVIDLKKEK 117
            + +     GL     E Y++F+AN+R  Q+G + P   Y  NP  W+   + +DL K  
Sbjct: 265 EQIIGNKIDGLLMSDLEAYIKFMANKRAEQMGFQAPFEGYRTNPLRWIVAYQEVDLGK-T 323

Query: 118 NFFETRVTEYQQGA 131
           +FFE +  +Y + +
Sbjct: 324 DFFEQKSRQYTKTS 337


>gi|218442220|ref|YP_002380549.1| ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 7424]
 gi|218174948|gb|ACK73681.1| Ribonucleoside-diphosphate reductase [Cyanothece sp. PCC 7424]
          Length = 355

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 70/144 (48%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I +     PH   + ++     M   A   E  + 
Sbjct: 215 MPGSADIFKMINRDELSHVRLYQRIIVEAMETFPHSVEQIYE-----MFDTAVQHECRWT 269

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R + IGL+PL+   KY ++P+  +    D KK+ 
Sbjct: 270 NHIVGDNILGITESSTEQYTKYLANHRLNTIGLKPLYEDEKYKKSPYSHLERFSDTKKDA 329

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +G+  WD
Sbjct: 330 HTKANFFEATVTSYVMSSGVTGWD 353


>gi|157869457|ref|XP_001683280.1| ribonucleoside-diphosphate reductase small chain [Leishmania major
           strain Friedlin]
 gi|68224164|emb|CAJ04657.1| putative ribonucleoside-diphosphate reductase small chain
           [Leishmania major strain Friedlin]
          Length = 392

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         + N H+  K  +++   ++ +A  +E  + 
Sbjct: 253 MPGLTFSNELISRDEGLHTDFAC------LLYNSHIKHKLPRERVLEIIVDAVNIEREFI 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G E  +  T+ PF +M E+I L+ + NFF
Sbjct: 307 CDALPVRLIGMNAELMAQYIEFVADRLLVSLGEEKHYHSTQ-PFEFM-EMISLQGKTNFF 364

Query: 121 ETRVTEYQQGA 131
           E +V EYQ+  
Sbjct: 365 ERKVGEYQKAG 375


>gi|223983469|ref|ZP_03633655.1| hypothetical protein HOLDEFILI_00935 [Holdemania filiformis DSM
           12042]
 gi|223964641|gb|EEF68967.1| hypothetical protein HOLDEFILI_00935 [Holdemania filiformis DSM
           12042]
          Length = 348

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 68/140 (48%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I +++ E P L+T E +Q  R ML +    EI + 
Sbjct: 208 MPGSVQEIRYINRDENTHLWLFRSMILELRKEEPQLFTPEREQLYREMLKQGVEEEIEWG 267

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GLN      Y++++ N R   I LE L+   E       W+S+  +    K
Sbjct: 268 CAILGDEIPGLNKTMIRDYIRYLGNLRAKAIHLEILYPGEEEEPASMKWVSQYANANLIK 327

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE R + Y + + LK D
Sbjct: 328 TDFFEARSSAYAKASALKDD 347


>gi|253574542|ref|ZP_04851883.1| ribonucleoside-diphosphate reductase, beta subunit [Paenibacillus
           sp. oral taxon 786 str. D14]
 gi|251846247|gb|EES74254.1| ribonucleoside-diphosphate reductase, beta subunit [Paenibacillus
           sp. oral taxon 786 str. D14]
          Length = 343

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 66/131 (50%), Gaps = 5/131 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++   YI RDE+ H  F  +V  Q+ I+ P L TKE    +   +  A  LE  +A
Sbjct: 202 MMGTSQMISYIQRDENQHCYFFAEVFKQLLIDYPELNTKENIDYAYRTIDRAVELETNWA 261

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE-NPFPWMSEVID--LKKEK 117
           H T+ K   G++      Y+++IAN+R   +GLE  +   + N  PW+    D  L   K
Sbjct: 262 HYTL-KNVPGIDLNELSDYIKYIANKRLTLMGLEKAYAGVDINCMPWIKPFSDEALNATK 320

Query: 118 -NFFETRVTEY 127
            +FFE +   Y
Sbjct: 321 TDFFEAKSRNY 331


>gi|325294459|ref|YP_004280973.1| ribonucleotide reductase [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064907|gb|ADY72914.1| ribonucleotide reductase [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 352

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 11/143 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRT--MLHEATLLEIA 58
           M G A+  +YI RDE  H+      +  +  E      K++  K +   M   A   E  
Sbjct: 212 MQGTADIIRYINRDELTHVILFEHFMKDLTDEE----FKKYLPKDKIYEMFKVAVNQEQR 267

Query: 59  YAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKE-- 116
           ++ + +    +G+N  S E+Y  ++AN+R   +GL+P+F  T NP+  +  + D   E  
Sbjct: 268 FSKKVIGNKILGMNEKSIEEYTYYVANKRLKALGLDPIFPDTPNPYEHLERIADTGGEGN 327

Query: 117 --KNFFETRVTEYQQGAGLK-WD 136
              NFFE  VT Y Q + ++ WD
Sbjct: 328 VKANFFEATVTSYNQASAVEGWD 350


>gi|166367085|ref|YP_001659358.1| ribonucleoside-diphosphate reductase beta chain [Microcystis
           aeruginosa NIES-843]
 gi|166089458|dbj|BAG04166.1| ribonucleoside-diphosphate reductase beta chain [Microcystis
           aeruginosa NIES-843]
          Length = 283

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 13/144 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A+ ++ I RDE  H+     +I +      H   + ++     M   A   E  + 
Sbjct: 143 MSGSADVFKMINRDELSHVRLYQKLIPEAMATFSHSVEQIYE-----MFDTAVKHECRWT 197

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKE- 116
           +  +    +G+   S EQY +++AN R   IGLEPL+   KY ++P+  +    D KKE 
Sbjct: 198 NHIVGNDILGITEYSTEQYTKYLANIRLKAIGLEPLYREEKYNKSPYNHLERFSDTKKEG 257

Query: 117 ---KNFFETRVTEYQQGAGLK-WD 136
               NFFE  VT Y   +GL  WD
Sbjct: 258 HTKANFFEATVTSYVMSSGLTGWD 281


>gi|168049349|ref|XP_001777126.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162671569|gb|EDQ58119.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 325

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 63/131 (48%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +   +         K  + +   ++ EA  +E  + 
Sbjct: 185 MPGLTFSNELISRDEGLHCDFACLLYTLLN-------NKLSEDRVHEIVCEAVDIEREFV 237

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    VG+N     +Y+ F+A+R    +G    +    NPF WM E+I L+ + NFF
Sbjct: 238 CEALSCDLVGMNKIMMSEYIDFVADRLLVSLGYNKRYN-ARNPFDWM-ELISLQGKTNFF 295

Query: 121 ETRVTEYQQGA 131
           E RV EYQ+ +
Sbjct: 296 EKRVGEYQKAS 306


>gi|255008714|ref|ZP_05280840.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           fragilis 3_1_12]
 gi|313146449|ref|ZP_07808642.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           fragilis 3_1_12]
 gi|313135216|gb|EFR52576.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           fragilis 3_1_12]
          Length = 349

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EI + 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPELFTSDRVKVYEAMMREGVKQEIEWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN    E Y+ ++ N R   +G  PL  Y +N        W+S+  +   
Sbjct: 269 QYVIGDEIQGLNKKMIEDYIHYLGNLRWTSLGFTPL--YEDNLKEPESMRWVSQYSNANM 326

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE + T Y +   L+ D
Sbjct: 327 VKTDFFEAKSTAYAKSTALEDD 348


>gi|15617531|ref|NP_258331.1| RR2B [Spodoptera litura NPV]
 gi|15553267|gb|AAL01745.1|AF325155_57 ribonucleotide reductase small subunit homolog [Spodoptera litura
           NPV]
          Length = 333

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F         +   H+  K  + +   ++ EA  +E  + 
Sbjct: 194 MPGLTFSNELISRDEGLHTDFAC-------LMYSHIVNKPTRDRILDIITEAVAIENEFV 246

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N     +Y++F+A+R   ++  E  +  T+NPF +M+ +I L+ + NFF
Sbjct: 247 TEALPVAMLGMNNDLMSKYIEFVADRLLLELIGERHYN-TKNPFDFMN-LISLEGKTNFF 304

Query: 121 ETRVTEYQQ 129
           E +V+EYQ+
Sbjct: 305 EKKVSEYQK 313


>gi|169824933|ref|YP_001692544.1| ribonucleotide-diphosphate reductase subunit beta [Finegoldia magna
           ATCC 29328]
 gi|167831738|dbj|BAG08654.1| ribonucleoside-diphosphate reductase beta subunit [Finegoldia magna
           ATCC 29328]
          Length = 354

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I  +K E P L+T+E   + + M+ +    EI +A
Sbjct: 214 MPGTVQEIRYINRDENTHLWLFRSMILDLKKERPELFTEEKNAQYKEMIKQGAEAEIEWA 273

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP---WMSEVIDLKKEK 117
              + +   GL+    E Y++++ N R   +G   ++   E   P   W+SE  D  K K
Sbjct: 274 KYVIGEKIQGLSIKMVEDYIKYLGNLRSTGLGFGVIYPGYEREIPSMKWVSEYSDPNKIK 333

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + + Y + A ++ D
Sbjct: 334 TDFFEAKPSAYSKSAIIEDD 353


>gi|60682187|ref|YP_212331.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           fragilis NCTC 9343]
 gi|60493621|emb|CAH08410.1| putative ribonucleoside-diphosphate reductase beta chain
           [Bacteroides fragilis NCTC 9343]
          Length = 349

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EIA+ 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPELFTPDKVKVYEEMMREGVKQEIAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GLN      Y+ F+ N R   +G  PL++          W+S+  +    K
Sbjct: 269 QYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVK 328

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y +   L+ D
Sbjct: 329 TDFFEAKSTAYAKSTALEDD 348


>gi|13242599|ref|NP_077613.1| EsV-1-128 [Ectocarpus siliculosus virus 1]
 gi|13177402|gb|AAK14546.1|AF204951_128 EsV-1-128 [Ectocarpus siliculosus virus 1]
          Length = 419

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 3   GIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHE 62
           G++     I RDE LH    + +   +K   P       +++   +   A  +E  +   
Sbjct: 284 GLSFANSLIARDEGLHATASVLIYKHLKNRLP-------RERVHEIFKHAVSVECEFISS 336

Query: 63  TMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFFET 122
            +P   +G++  S  +Y++F+A+   +Q+G + ++    NPF WM ++I L+ + NFFE 
Sbjct: 337 ALPVALIGISEKSMTEYIKFVADYWLNQLGYDKVYN-CANPFEWM-DMISLQGKTNFFEN 394

Query: 123 RVTEYQQGAGL 133
           RV EY +   L
Sbjct: 395 RVAEYSKPGVL 405


>gi|53713986|ref|YP_099978.1| ribonucleotide-diphosphate reductase subunit beta [Bacteroides
           fragilis YCH46]
 gi|52216851|dbj|BAD49444.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides
           fragilis YCH46]
          Length = 349

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EIA+ 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPELFTPDKVKVYEEMMREGVKQEIAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GLN      Y+ F+ N R   +G  PL++          W+S+  +    K
Sbjct: 269 QYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVK 328

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y +   L+ D
Sbjct: 329 TDFFEAKSTAYAKSTALEDD 348


>gi|253567022|ref|ZP_04844473.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides sp.
           3_2_5]
 gi|265764336|ref|ZP_06092904.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides sp.
           2_1_16]
 gi|15290503|gb|AAK92210.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides
           fragilis 638R]
 gi|251944146|gb|EES84655.1| ribonucleoside-diphosphate reductase subunit B [Bacteroides sp.
           3_2_5]
 gi|263256944|gb|EEZ28290.1| ribonucleoside-diphosphate reductase, beta subunit [Bacteroides sp.
           2_1_16]
 gi|301163665|emb|CBW23219.1| putative ribonucleoside-diphosphate reductase beta chain
           [Bacteroides fragilis 638R]
          Length = 349

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    ++I ++K E P L+T +  +    M+ E    EIA+ 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNIILELKKEEPELFTPDKVKVYEEMMREGVKQEIAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN---PFPWMSEVIDLKKEK 117
              +     GLN      Y+ F+ N R   +G  PL++          W+S+  +    K
Sbjct: 269 QYVIGDQIQGLNRQMISDYIHFLGNLRWSSLGYTPLYEDNRKEPESMHWVSQYSNANMVK 328

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + T Y +   L+ D
Sbjct: 329 TDFFEAKSTAYAKSTALEDD 348


>gi|119478853|ref|XP_001259462.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya
           fischeri NRRL 181]
 gi|119407616|gb|EAW17565.1| ribonucleotide reductase small subunit RnrA, putative [Neosartorya
           fischeri NRRL 181]
          Length = 405

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +  ++    ++ EA  +E  + 
Sbjct: 256 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNHRPDKKVVEDIIVEAVAIEQEFL 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+    QY++F+A+R    +G +  +  + NPF +M E I L  + NFF
Sbjct: 309 TEALPVALLGMNSKLMCQYIEFVADRLLVALGNKKYYN-SSNPFDFM-ESISLAGKTNFF 366

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 367 EKRVGDYQKAG 377


>gi|40556174|ref|NP_955259.1| CNPV236 ribonucleotide reductase small subunit [Canarypox virus]
 gi|40233999|gb|AAR83582.1| CNPV236 ribonucleotide reductase small subunit [Canarypox virus]
          Length = 323

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         +L  K  Q +   ++  A  +E  + 
Sbjct: 185 MPGLTFSNELISRDEGLHCDFACLLFTN------YLSHKPSQDRVYEIIDSAVSVETEFL 238

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +    +G+N+ S  +Y++F+++R    +G    +   ENPF +M E I L+ + NFF
Sbjct: 239 TEALSIDLIGMNSKSMIEYIKFVSDRLLVSLGFSKKYN-VENPFSFM-ENISLEGKANFF 296

Query: 121 ETRVTEYQQ 129
           E RV+ YQ+
Sbjct: 297 EKRVSNYQK 305


>gi|209170936|ref|YP_002268082.1| agip52 [Agrotis ipsilon multiple nucleopolyhedrovirus]
 gi|208436527|gb|ACI28754.1| ribonucleotide reductase-2B [Agrotis ipsilon multiple
           nucleopolyhedrovirus]
          Length = 313

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 73/134 (54%), Gaps = 11/134 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKS-RTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   +  + ++      T++    +  +M  EA  +E  +
Sbjct: 179 MPGLTFSNELISRDEGLHTDFAC-LYYKTRV------TEKLDSDTILSMFKEAVAIEKEF 231

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
               +P   +G+NA S  +Y++F+A+R   Q+G +P +    NPF +M+  I L+ + NF
Sbjct: 232 FTAALPVELLGMNAQSMCEYIEFVADRLLVQLG-QPKYFNARNPFEFMNN-ISLEGKTNF 289

Query: 120 FETRVTEYQQ-GAG 132
           FE RV EY++ GAG
Sbjct: 290 FEKRVGEYKRFGAG 303


>gi|291461082|ref|ZP_06026838.2| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           periodonticum ATCC 33693]
 gi|291379059|gb|EFE86577.1| ribonucleoside-diphosphate reductase, beta subunit [Fusobacterium
           periodonticum ATCC 33693]
          Length = 348

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 67/138 (48%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P  ++ E      +M   A   EI + 
Sbjct: 208 MVGTSDIIRLINRDELSHVVLFRSIVKEIKNDYPEFFSAE---TIYSMFKTAVEQEINWT 264

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPL+  + +NP+  +    D + E   
Sbjct: 265 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLYSGFNKNPYKHLERFADTEGEGNV 324

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 325 KSNFFEGTVTSYNMSSSI 342


>gi|269865627|ref|XP_002651990.1| ribonucleoside-diphosphate reductase small chain [Enterocytozoon
           bieneusi H348]
 gi|220063361|gb|EED42066.1| ribonucleoside-diphosphate reductase small chain [Enterocytozoon
           bieneusi H348]
          Length = 290

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   +         H +          ++ EA  +E  + 
Sbjct: 156 MPGLTFSNELISRDEGLHTDFACLL---------HKYINNKCTVIEDIVREAVAIEQEFL 206

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E++P   +G+N     QY++F+A+R    +G + ++  + NPF +M E I L+ + NFF
Sbjct: 207 SESLPVSLIGMNCKLMCQYIEFVADRLLFALGEKKIYNVS-NPFDFM-ENISLQGKTNFF 264

Query: 121 ETRVTEYQQG 130
           E R T YQ+G
Sbjct: 265 ERRETNYQKG 274


>gi|164659270|ref|XP_001730759.1| hypothetical protein MGL_1758 [Malassezia globosa CBS 7966]
 gi|159104657|gb|EDP43545.1| hypothetical protein MGL_1758 [Malassezia globosa CBS 7966]
          Length = 397

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 9/136 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G++   + I RDE LH +F   + +       HL  +        ++ EA  +E  + 
Sbjct: 254 MPGLSFSNELISRDEGLHTDFACLLFS-------HLKKRAHPDTVNRIITEAVDIEQDFL 306

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G  P    + NPF +M E I L+ + NFF
Sbjct: 307 TDALPVSLIGMNARLMCQYIEFVADRLLVALG-NPKHYNSTNPFDFM-ENISLQGKSNFF 364

Query: 121 ETRVTEYQQGAGLKWD 136
           E RV +Y +    + D
Sbjct: 365 ERRVGDYAKAGVARAD 380


>gi|302379704|ref|ZP_07268189.1| ribonucleoside-diphosphate reductase, beta subunit [Finegoldia
           magna ACS-171-V-Col3]
 gi|302312611|gb|EFK94607.1| ribonucleoside-diphosphate reductase, beta subunit [Finegoldia
           magna ACS-171-V-Col3]
          Length = 347

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I  +K E P L+T+E   + + M+ +    EI +A
Sbjct: 207 MPGTVQEIRYINRDENTHLWLFRSMILDLKKERPELFTEEKNAQYKEMIKQGAEAEIEWA 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP---WMSEVIDLKKEK 117
              + +   GL+    E Y++++ N R   +G   ++   E   P   W+SE  D  K K
Sbjct: 267 KYVIGEKIQGLSIKMVEDYIKYLGNLRSTGLGFGVIYPGYEREIPSMKWVSEYSDPNKIK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + + Y + A ++ D
Sbjct: 327 TDFFEAKPSAYSKSAIIEDD 346


>gi|303234233|ref|ZP_07320879.1| ribonucleoside-diphosphate reductase, beta subunit [Finegoldia
           magna BVS033A4]
 gi|302494774|gb|EFL54534.1| ribonucleoside-diphosphate reductase, beta subunit [Finegoldia
           magna BVS033A4]
          Length = 347

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  ++ +YI RDE+ HL     +I  +K E P L+T+E   + + M+ +    EI +A
Sbjct: 207 MPGTVQEIRYINRDENTHLWLFRSMILDLKKERPELFTEEKNAQYKEMIKQGAEAEIEWA 266

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFP---WMSEVIDLKKEK 117
              + +   GL+    E Y++++ N R   +G   ++   E   P   W+SE  D  K K
Sbjct: 267 KYVIGEKIQGLSIKMVEDYIKYLGNLRSTGLGFGVIYPGYEREIPSMKWVSEYSDPNKIK 326

Query: 118 -NFFETRVTEYQQGAGLKWD 136
            +FFE + + Y + A ++ D
Sbjct: 327 TDFFEAKPSAYSKSAIIEDD 346


>gi|289742419|gb|ADD19957.1| ribonucleotide reductase beta subunit [Glossina morsitans
           morsitans]
          Length = 396

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F + +         HL  K  +++   ++ +A  +E  + 
Sbjct: 259 MPGLTFSNEMISRDEGLHCEFAVLMFK-------HLIQKPSKERILEIITDAVKIEKEFL 311

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            E +P   +G+N+ S  +Y++++A+R   ++ +   +   ENPF +M++ I +  + NFF
Sbjct: 312 TEALPVDLIGMNSESMCKYIEYVADRLLLELDVGKYY-LAENPFEFMNK-ISIDGKTNFF 369

Query: 121 ETRVTEYQQ 129
           E RV EYQ+
Sbjct: 370 EKRVGEYQK 378


>gi|237738722|ref|ZP_04569203.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 2_1_31]
 gi|229423825|gb|EEO38872.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 2_1_31]
          Length = 344

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 67/138 (48%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P  ++ E      +M   A   EI + 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSIVKEIKNDYPEFFSAE---TIYSMFKTAVEQEINWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPL+  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLYSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|163955147|ref|YP_001648251.1| hypothetical protein OsV5_174r [Ostreococcus virus OsV5]
 gi|163638596|gb|ABY27955.1| hypothetical protein OsV5_174r [Ostreococcus virus OsV5]
          Length = 322

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F +++   ++   P + T         ++ EA  +E  + 
Sbjct: 189 MPGLCFSNELISRDEGLHQEFAVELFKTLR-NRPGVDT------IHAIVREAVEIEKGFI 241

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++++++R   QIG+ P    ++NPF +M E I L  + NFF
Sbjct: 242 LDALPCNLIGMNSEKMSEYIEYVSDRLLKQIGV-PTIWNSKNPFDFM-ENISLDGKTNFF 299

Query: 121 ETRVTEY 127
           E RV +Y
Sbjct: 300 EKRVGDY 306


>gi|290343623|ref|YP_003494990.1| hypothetical protein OTV1_151 [Ostreococcus tauri virus 1]
 gi|260161038|emb|CAY39739.1| hypothetical protein OTV1_151 [Ostreococcus tauri virus 1]
          Length = 389

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH  F +++   ++   P + T         ++ EA  +E  + 
Sbjct: 256 MPGLCFSNELISRDEGLHQEFAVELFKTLR-NRPGVDT------IHAIVREAVDIEKGFI 308

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    +Y++++++R   QIG+ P    ++NPF +M E I L  + NFF
Sbjct: 309 LDALPCNLIGMNSEKMSEYIEYVSDRLLKQIGV-PTIWNSKNPFDFM-ENISLDGKTNFF 366

Query: 121 ETRVTEY 127
           E RV +Y
Sbjct: 367 EKRVGDY 373


>gi|167461830|ref|ZP_02326919.1| ribonucleoside-diphosphate reductase beta subunit [Paenibacillus
           larvae subsp. larvae BRL-230010]
 gi|322383591|ref|ZP_08057349.1| ribonucleotide-diphosphate reductase subunit beta-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321152059|gb|EFX44995.1| ribonucleotide-diphosphate reductase subunit beta-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 343

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 68/132 (51%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M+G ++   YI RDE+ H  F  +V   +  + P L T E  Q     + +A  LE  +A
Sbjct: 203 MLGTSQMISYIQRDEAQHAYFFGEVFKLLLTDFPELNTSERIQYVYDTIDQAVKLEEKWA 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVID--LKKEK- 117
           H  + +   G++     +Y++FIAN+R   +GL+P ++  +N  PW+    D  L + K 
Sbjct: 263 HYVLNQ-IDGIDLDDFSRYIRFIANKRLKTMGLQPAYEGVDNCMPWIRPFSDEALNQTKT 321

Query: 118 NFFETRVTEYQQ 129
           +FFE +   Y +
Sbjct: 322 DFFEAKSRTYAK 333


>gi|260950985|ref|XP_002619789.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
 gi|238847361|gb|EEQ36825.1| hypothetical protein CLUG_00948 [Clavispora lusitaniae ATCC 42720]
          Length = 419

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 11/132 (8%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIE-NPHLWTKEFQQKSRTMLHEATLLEIAY 59
           M G+    + I RDE LH +F   + + +    NP +  K        ++ EA  +E  Y
Sbjct: 277 MPGLTFSNELICRDEGLHTDFACLLFSHLNNRPNPAIVEK--------IITEAVTIEKEY 328

Query: 60  AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
             + +P   +G+N     QY++F+A+R    +G + ++  T NPF +M E I L  + NF
Sbjct: 329 FTDALPASLLGMNCDLMCQYVEFVADRLLVALGNKKVYNVT-NPFDFM-ENISLAGKTNF 386

Query: 120 FETRVTEYQQGA 131
           FE RV++YQ+  
Sbjct: 387 FEKRVSDYQKAG 398


>gi|56418235|gb|AAV91049.1| ribonucleotide reductase beta subunit [Grouper iridovirus]
          Length = 384

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (47%), Gaps = 6/136 (4%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAY- 59
           M G+ +  ++ +RDE++H+     +   +  E P L T++  +  +     A  LE A+ 
Sbjct: 242 MKGMGKVVEWSVRDENIHVEGVSRLFETLCAEYPWLMTEKLVRDCKKDAERAAELEFAFI 301

Query: 60  --AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY--TENPFPWMSEVIDLKK 115
             A    P    GL   S + Y+ ++ N R   +GL  L     +ENP PW+  +I+   
Sbjct: 302 DLAFSYCP-ALDGLTPSSVKNYVLYVINLRASHMGLPKLMASAPSENPLPWVKWLIEGAD 360

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE  VTEY+ G 
Sbjct: 361 LTNFFENHVTEYETGG 376


>gi|326472581|gb|EGD96590.1| ribonucleotide reductase small subunit RnrA [Trichophyton tonsurans
           CBS 112818]
          Length = 408

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +        ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNYRPDPNAVEAIITEAVTIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYN-TTNPFDFMDN-ISLAGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|323343338|ref|ZP_08083565.1| ribonucleotide-diphosphate reductase beta subunit [Prevotella
           oralis ATCC 33269]
 gi|323095157|gb|EFZ37731.1| ribonucleotide-diphosphate reductase beta subunit [Prevotella
           oralis ATCC 33269]
          Length = 349

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G A++ +YI RDE+ HL    +++ ++K E P ++T E  +    M+ E    EIA+ 
Sbjct: 209 MSGSAQEIRYINRDENTHLWLFRNILQELKKEEPKMFTPEKVKVYEEMMREGVRQEIAWG 268

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTEN-----PFPWMSEVIDLKK 115
              +     GLN      Y+ ++ N R H +G   L  Y EN        W+S+  +   
Sbjct: 269 QYVIGDEVPGLNTKMVSDYIHYLGNLRWHSLGFGYL--YDENIQEPENMKWVSQYSNANM 326

Query: 116 EK-NFFETRVTEYQQGAGLKWD 136
            K +FFE + T Y +   L+ D
Sbjct: 327 VKTDFFEAKSTAYAKSTALEDD 348


>gi|237742881|ref|ZP_04573362.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 4_1_13]
 gi|229430529|gb|EEO40741.1| ribonucleoside-diphosphate reductase subunit beta [Fusobacterium
           sp. 4_1_13]
          Length = 344

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 8/138 (5%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           MVG ++  + I RDE  H+     ++ +IK + P+ ++ E      +M   A   EI + 
Sbjct: 204 MVGTSDIIRLINRDELSHVVLFRSMVKEIKNDFPNFFSAE---TIYSMFKTAVEQEITWT 260

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVIDLKKE--- 116
              +    +G+ + + E Y +++AN R   +GLEPL+  + +NP+  +    D + E   
Sbjct: 261 EHIIGNRVLGITSQTTEAYTKWLANERLKSLGLEPLYSGFNKNPYKHLERFADTEGEGNV 320

Query: 117 -KNFFETRVTEYQQGAGL 133
             NFFE  VT Y   + +
Sbjct: 321 KSNFFEGTVTSYNMSSSI 338


>gi|157325080|ref|YP_001468505.1| gp125 [Listeria phage A511]
 gi|66732769|gb|AAY53360.1| gp57 [Listeria phage P100]
 gi|66733088|gb|AAY52906.1| gp125 [Listeria phage A511]
          Length = 343

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 4/132 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G  +   +I RDE  H  F  ++I  I  ENP L T E           A  LE A++
Sbjct: 203 MTGTGKIISFINRDELAHSKFISELIRAIVGENPELQTDELNDYVYASFRHAVELEQAWS 262

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVID--LKKEK 117
            E + +G  G++      Y+++ AN+    +GL+P+++ +TEN   W+    D   + + 
Sbjct: 263 SEVL-QGIEGIDVEEMLDYVKYRANKMLGMLGLQPMYQGHTENSMTWIKAYADNFTETKT 321

Query: 118 NFFETRVTEYQQ 129
           +FFE R + Y++
Sbjct: 322 DFFEMRNSSYKK 333


>gi|327298815|ref|XP_003234101.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
 gi|326464279|gb|EGD89732.1| ribonucleotide reductase small subunit RnrA [Trichophyton rubrum
           CBS 118892]
          Length = 408

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +        ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNYRPDPSAVEAIITEAVTIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYN-TTNPFDFMDN-ISLAGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|56692684|ref|YP_164142.1| ribonucleoside-diphosphate reductase beta subunit [Singapore
           grouper iridovirus]
 gi|42517396|gb|AAS18062.1| ribonucleoside-diphosphate reductase beta subunit [Singapore
           grouper iridovirus]
          Length = 384

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (47%), Gaps = 6/136 (4%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAY- 59
           M G+ +  ++ +RDE++H+     +   +  E P L T++  +  +     A  LE A+ 
Sbjct: 242 MKGMGKVVEWSVRDENIHVEGVSRLFETLCAEYPWLMTEKLVRDCKKDAERAAELEFAFI 301

Query: 60  --AHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKY--TENPFPWMSEVIDLKK 115
             A    P    GL   S + Y+ ++ N R   +GL  L     +ENP PW+  +I+   
Sbjct: 302 DLAFSYCP-ALDGLTPSSVKNYVLYVINLRASHMGLPKLMASAPSENPLPWVKWLIEGAD 360

Query: 116 EKNFFETRVTEYQQGA 131
             NFFE  VTEY+ G 
Sbjct: 361 LTNFFENHVTEYETGG 376


>gi|90592764|ref|YP_529717.1| RR2B [Agrotis segetum nucleopolyhedrovirus]
 gi|71559214|gb|AAZ38213.1| RR2B [Agrotis segetum nucleopolyhedrovirus]
          Length = 313

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (49%), Gaps = 9/133 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F           N  +  K       +M  EA  +E  + 
Sbjct: 179 MPGLTFSNELISRDEGLHTDFAC------LYYNTRVHDKLAPDTVLSMFKEAVAIEKEFF 232

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
              +P   +G+NA S   Y++F+A+R   Q+  +P   +  NPF +M+  I L+ + NFF
Sbjct: 233 TAALPAALLGMNAQSMCDYIEFVADRLLVQLH-QPKHFHARNPFEFMNN-ISLEGKTNFF 290

Query: 121 ETRVTEYQQ-GAG 132
           E RV EY++ GAG
Sbjct: 291 EKRVGEYKRFGAG 303


>gi|302497417|ref|XP_003010709.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
 gi|291174252|gb|EFE30069.1| hypothetical protein ARB_03411 [Arthroderma benhamiae CBS 112371]
          Length = 408

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +        ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNYRPDPSAVEAIITEAVTIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYN-TTNPFDFMDN-ISLAGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|303314521|ref|XP_003067269.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240106937|gb|EER25124.1| ribonucleoside-diphosphate reductase small chain, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320037571|gb|EFW19508.1| ribonucleoside-diphosphate reductase small subunit [Coccidioides
           posadasii str. Silveira]
          Length = 408

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +  + ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPGPEAVQAIITEAVEIEKEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYNAT-NPFDFMDN-ISLSGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|119174781|ref|XP_001239725.1| hypothetical protein CIMG_09346 [Coccidioides immitis RS]
          Length = 408

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +   +  + ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLRHRPGPEAVQAIITEAVEIEKEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+N+    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNSKLMCQYIEFVADRLLVALGNKKFYNAT-NPFDFMDN-ISLSGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|315041979|ref|XP_003170366.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
 gi|311345400|gb|EFR04603.1| ribonucleoside-diphosphate reductase small subunit [Arthroderma
           gypseum CBS 118893]
          Length = 408

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + +       HL  +        ++ EA  +E  + 
Sbjct: 260 MPGLTFSNELISRDEGLHTDFACLLFS-------HLNHRPEPSAVEAIITEAVTIEQEFL 312

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120
            + +P   +G+NA    QY++F+A+R    +G +  +  T NPF +M   I L  + NFF
Sbjct: 313 TDALPCALLGMNAKLMCQYIEFVADRLLVALGNKKFYN-TTNPFDFMDN-ISLAGKTNFF 370

Query: 121 ETRVTEYQQGA 131
           E RV +YQ+  
Sbjct: 371 EKRVGDYQKAG 381


>gi|297736972|emb|CBI26173.3| unnamed protein product [Vitis vinifera]
          Length = 312

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+    + I RDE LH +F   + + ++ + P  W     QK   ++HEA  +E  + 
Sbjct: 159 MPGLTFSNELISRDEGLHCDFACLLYSLLQKQLP--W-----QKVHHIVHEAVEIETQFV 211

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEK 117
            E +P   +G+NA    QY++F+A+R    +G E  +   ENPF WM E I L+  +
Sbjct: 212 CEALPCALIGMNATLMSQYIKFVADRLLVALGYERKYN-VENPFDWM-EFISLQCSR 266


>gi|302381236|ref|YP_003817059.1| ribonucleoside-diphosphate reductase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302191864|gb|ADK99435.1| Ribonucleoside-diphosphate reductase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 348

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 2/132 (1%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           M G+ +   + +RDESLH +  I + +    E   + TK               LE  + 
Sbjct: 189 MKGMGQIVSWSVRDESLHCDGIIKLYHAFNKETGVV-TKAVADDIVQCCETVVGLEDKFI 247

Query: 61  HETMPKGFV-GLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
                 G + G+     +QY++FIA+ R  Q+ L  L+   ENP PW+  ++   +  NF
Sbjct: 248 DLAFEAGEINGMTPEDIKQYIRFIADWRLRQLKLPELYGVKENPLPWLQSLLSGVEHANF 307

Query: 120 FETRVTEYQQGA 131
           FE R TEY + A
Sbjct: 308 FEARATEYSKAA 319


>gi|270000178|gb|ACZ57936.1| m015L [Myxoma virus]
          Length = 103

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 42  QQKSRTMLHEATLLEIAYAHETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE 101
           +++  +++ EA ++E  +  E +P   +G+N     QY++F+A+R   ++G   +F  T 
Sbjct: 1   EERVASIIKEAVVIEQRFLTEALPVRLIGMNCELMCQYIEFVADRLIAELGYSKIFSAT- 59

Query: 102 NPFPWMSEVIDLKKEKNFFETRVTEYQQ 129
           NPF +M E I L+ + NFFE RV++YQ+
Sbjct: 60  NPFDFM-ENISLEGKTNFFEKRVSDYQR 86


>gi|302665732|ref|XP_003024474.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
 gi|291188529|gb|EFE43863.1| hypothetical protein TRV_01368 [Trichophyton verrucosum HKI 0517]
          Length = 529

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gap