PSIBLAST alignment of GI: peg_75 and protein with PDB id: 1av8

>gi|3891582|pdb|1AV8|A Chain A, Ribonucleotide Reductase R2 Subunit From E. Coli Length = 340
>gi|3891583|pdb|1AV8|B Chain B, Ribonucleotide Reductase R2 Subunit From E. Coli Length = 340
 Score = 86.2 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVIN--QIKIENPHL--WTKEFQQKSRTMLHEATLLE 56
           M G A+  + I RDE+LHL     ++N  +   ++P +    +E +Q+   +  +A   E
Sbjct: 224 MEGNAKIIRLIARDEALHLTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQE 283

Query: 57  IAYAHETMPK-GFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI 111
             +A         +GLN     QY+++I N R   +GL+  F+   NP PW++  +
Sbjct: 284 KDWADYLFRDGSMIGLNKDILCQYVEYITNIRMQAVGLDLPFQTRSNPIPWINTWL 339