PSIBLAST alignment of GI: peg_75 and protein with PDB id: 1rsr

>gi|40889712|pdb|1RSR|A Chain A, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase Length = 375
>gi|40889713|pdb|1RSR|B Chain B, Azide Complex Of The Diferrous F208a Mutant R2 Subunit Of Ribonucleotide Reductase Length = 375
 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 63/136 (46%), Gaps = 6/136 (4%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVIN--QIKIENPHL--WTKEFQQKSRTMLHEATLLE 56
           M G A+  + I RDE+LHL     ++N  +   ++P +    +E +Q+   +  +A   E
Sbjct: 224 MEGNAKIIRLIARDEALHLTGTQHMLNLLRSGADDPEMAEIAEECKQECYDLFVQAAQQE 283

Query: 57  IAYAHETMPK-GFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVI-DLK 114
             +A         +GLN     QY+++I N R   +GL+  F+   NP PW++  +    
Sbjct: 284 KDWADYLFRDGSMIGLNKDILCQYVEYITNIRMQAVGLDLPFQTRSNPIPWINTWLVSDN 343

Query: 115 KEKNFFETRVTEYQQG 130
            +    E  V+ Y  G
Sbjct: 344 VQVAPQEVEVSSYLVG 359