PSIBLAST alignment of GI: peg_75 and protein with PDB id: 3n37

gi|303325061|pdb|3N37|A Chain A, Ribonucleotide Reductase Dimanganese(Ii)-Nrdf From Escherichia Coli Length = 319
>gi|303325062|pdb|3N38|A Chain A, Ribonucleotide Reductase Nrdf From Escherichia Coli Soaked With Ferrous Ions Length = 319
 Score = 59.2 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 53/134 (39%), Gaps = 6/134 (4%)

Query: 4   IAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYAHET 63
            A+  + I+RDE++H  +      +   +      +E +  +  +L E    E+ Y  E 
Sbjct: 181 TADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDEL 240

Query: 64  MPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTE---NPFPWMSEVIDLKKEKNFF 120
             +      A   + ++ + AN+    +G EPLF       NP    +   +  +  +FF
Sbjct: 241 YAETPW---ADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFF 297

Query: 121 ETRVTEYQQGAGLK 134
               + Y  G  ++
Sbjct: 298 SGSGSSYVMGKAVE 311