RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.75_1 (136 letters) >gnl|CDD|30557 COG0208, NrdF, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism]. Length = 348 Score = 145 bits (368), Expect = 3e-36 Identities = 52/132 (39%), Positives = 76/132 (57%), Gaps = 1/132 (0%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60 M G AE + I+RDE+LHL F +I ++ ENP LWT E + + + EA LE YA Sbjct: 207 MPGTAEIIRLIIRDEALHLYFIGYLIQRLVAENPELWTAELKDEIYDLFKEAVELEKEYA 266 Query: 61 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120 P GL +QY+++ AN+R +GLEPL+ ENP PW+ + ++ +FF Sbjct: 267 EYLYPGIL-GLTEDLVKQYIRYNANKRLQNLGLEPLYPAEENPIPWIELSLSADEKTDFF 325 Query: 121 ETRVTEYQQGAG 132 E RV+ YQ+G+ Sbjct: 326 EGRVSSYQKGSV 337 >gnl|CDD|153108 cd01049, RNRR2, Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain. Ribonucleotide Reductase, R2/beta subunit (RNRR2) is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The RNR protein catalyzes the conversion of ribonucleotides to deoxyribonucleotides and is found in all eukaryotes, many prokaryotes, several viruses, and few archaea. The catalytically active form of RNR is a proposed alpha2-beta2 tetramer. The homodimeric alpha subunit (R1) contains the active site and redox active cysteines as well as the allosteric binding sites. The beta subunit (R2) contains a diiron cluster that, in its reduced state, reacts with dioxygen to form a stable tyrosyl radical and a diiron(III) cluster. This essential tyrosyl radical is proposed to generate a thiyl radical, located on a cysteine residue in the R1 active site that initiates ribonucleotide reduction. The beta subunit is composed of 10-13 helices, the 8 longest helices form an alpha-helical bundle; some have 2 addition beta strands. Yeast is unique in that it assembles both homodimers and heterodimers of RNRR2. The yeast heterodimer, Y2Y4, contains R2 (Y2) and a R2 homolog (Y4) that lacks the diiron center and is proposed to only assist in cofactor assembly, and perhaps stabilize R1 (Y1) in its active conformation. Length = 288 Score = 121 bits (306), Expect = 6e-29 Identities = 47/113 (41%), Positives = 72/113 (63%), Gaps = 1/113 (0%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60 M G+AE + I RDESLH +F +I ++ ENP L+T+EF+++ ++ EA LE +A Sbjct: 176 MPGLAEIIELISRDESLHGDFACLLIRELLNENPELFTEEFKEEVYELIKEAVELEKEFA 235 Query: 61 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFK-YTENPFPWMSEVID 112 + +P G +GLN +QY++++ANRR +GLE LF +NPF WM + D Sbjct: 236 RDLLPDGILGLNKEDMKQYIEYVANRRLENLGLEKLFNVEDKNPFDWMELISD 288 >gnl|CDD|36780 KOG1567, KOG1567, KOG1567, Ribonucleotide reductase, beta subunit [Nucleotide transport and metabolism]. Length = 344 Score = 77.3 bits (190), Expect = 1e-15 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 9/129 (6%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60 M G+ + I RDE LH +F + HL K +++ ++ EA +E + Sbjct: 207 MPGLTFSNELISRDEGLHCDFAC-------LLFSHLKKKPNEERIEEIITEAVEIEQEFL 259 Query: 61 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNFF 120 E +P +G+N QY++F+A+R ++G E + ENPF +M E I L + NFF Sbjct: 260 TEALPVNLIGMNCDLMSQYIEFVADRLLVELGNEKYYN-AENPFDFM-ENISLAGKTNFF 317 Query: 121 ETRVTEYQQ 129 E RV+EYQ+ Sbjct: 318 EKRVSEYQK 326 >gnl|CDD|144013 pfam00268, Ribonuc_red_sm, Ribonucleotide reductase, small chain. Length = 281 Score = 58.9 bits (143), Expect = 5e-10 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 6/108 (5%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60 M G + + I RDE+LH + + N K ++ + EA +EI + Sbjct: 180 MPGTCQSNELISRDEALHTDAACLLYNNYLGLE-----KPEPKRIYKLFREAVEIEIEFI 234 Query: 61 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPFPWMS 108 P G+N + +QY++F A+R IG +PLF NPF ++ Sbjct: 235 EAAAPVDVHGMNVRAIKQYIEFSADRLLVAIGYKPLFN-VPNPFFPLA 281 >gnl|CDD|153120 cd07911, RNRR2_Rv0233_like, Ribonucleotide Reductase R2-like protein, Mn/Fe-binding domain. Rv0233 is a Mycobacterium tuberculosis ribonucleotide reductase R2 protein with a heterodinuclear manganese/iron-carboxylate cofactor located in its metal center. The Rv0233-like family may represent a structural/functional counterpart of the evolutionary ancestor of the RNRR2's (Ribonucleotide Reductase, R2/beta subunit) and the bacterial multicomponent monooxygenases. RNRR2s belong to a broad superfamily of ferritin-like diiron-carboxylate proteins. The RNR protein catalyzes the conversion of ribonucleotides to deoxyribonucleotides and is found in prokaryotes and archaea. The catalytically active form of RNR is a proposed alpha2-beta2 tetramer. The homodimeric alpha subunit (R1) contains the active site and redox active cysteines as well as the allosteric binding sites. Length = 280 Score = 31.9 bits (73), Expect = 0.057 Identities = 20/94 (21%), Positives = 36/94 (38%), Gaps = 2/94 (2%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60 + G+ E + + DES H+ +G ++ + W F+++ ++ A L I Sbjct: 176 LPGMQEGIRRLGDDESRHIAWGTFTCRRLVAADDANWDV-FEERMNELVPHALGL-IDEI 233 Query: 61 HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLE 94 E + GL+ QY RR I Sbjct: 234 FELYDEMPFGLDPDELMQYAVDQFQRRLGYIERA 267 >gnl|CDD|176781 cd08803, Death_ank3, Death domain of Ankyrin-3. Death Domain (DD) of the human protein ankyrin-3 (ANK-3) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-3, also called anykyrin-G (for general or giant), is found in neurons and at least one splice variant has been shown to be essential for propagation of action potentials as a binding partner to neurofascin and voltage-gated sodium channels. It is required for maintaining axo-dendritic polarity, and may be a genetic risk factor associated with bipolar disorder. ANK-3 may also play roles in other cell types. Mutations affecting ANK-3 pathways for Na channel localization are associated with Brugada syndrome, a potentially fata arrythmia. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes. Length = 84 Score = 30.0 bits (67), Expect = 0.20 Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 19 LNFGIDVINQIKIENPHLWTKE 40 LNF +D INQI++ENP+ + Sbjct: 25 LNFSVDEINQIRVENPNSLIAQ 46 >gnl|CDD|176732 cd08317, Death_ank, Death domain associated with Ankyrins. Death Domain (DD) associated with Ankyrins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. Ankyrins function as adaptor proteins and they interact, through ANK repeats, with structurally diverse membrane proteins, including ion channels/pumps, calcium release channels, and cell adhesion molecules. They play critical roles in the proper expression and membrane localization of these proteins. In mammals, this family includes ankyrin-R for restricted (or ANK1), ankyrin-B for broadly expressed (or ANK2) and ankyrin-G for general or giant (or ANK3). They are expressed in different combinations in many tissues and play non-overlapping functions. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes. Length = 84 Score = 28.4 bits (64), Expect = 0.66 Identities = 10/33 (30%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Query: 18 HLNFGIDVINQIKIENPHLWTKEFQQKSRTMLH 50 L I+ IK ENP+ Q+++ ML Sbjct: 24 ELGVSETDIDLIKAENPN----SLAQQAQAMLK 52 >gnl|CDD|34330 COG4714, COG4714, Uncharacterized membrane-anchored protein conserved in bacteria [Function unknown]. Length = 303 Score = 26.9 bits (59), Expect = 1.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 64 MPKGFVGLNAPSCEQYMQFIANR 86 +P G + + A QYM+ I N Sbjct: 67 LPAGMIFIPAEEANQYMELIGNN 89 >gnl|CDD|176783 cd08805, Death_ank1, Death domain of Ankyrin-1. Death Domain (DD) of the human protein ankyrin-1 (ANK-1) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-1, also called ankyrin-R (for restricted), is found in brain, muscle, and erythrocytes and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. It plays a critical nonredundant role in erythroid development and is associated with hereditary spherocytosis (HS), a common disorder of the red cell membrane. The small alternatively-spliced variant, sANK-1, found in striated muscle and concentrated in the sarcoplasmic reticulum (SR) binds obscurin and titin, which facilitates the anchoring of the network SR to the contractile apparatus. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes. Length = 84 Score = 26.8 bits (59), Expect = 1.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 1 MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPH 35 M I E + + L F ++ IN+I++ENP+ Sbjct: 7 MAVIREHLGLSWAELARELQFSVEDINRIRVENPN 41 >gnl|CDD|144063 pfam00330, Aconitase, Aconitase family (aconitate hydratase). Length = 464 Score = 25.9 bits (57), Expect = 3.6 Identities = 9/23 (39%), Positives = 11/23 (47%), Gaps = 5/23 (21%) Query: 88 CHQIGLEPLFKYTENPFPWMSEV 110 HQIGLE F P ++ V Sbjct: 109 VHQIGLENGFT-----LPGLTLV 126 >gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]. Length = 444 Score = 25.6 bits (56), Expect = 5.1 Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 4 IAEQYQYIMRDESLHLNFGIDVINQI 29 + +QY+ +++ E + L F D I +I Sbjct: 352 LIKQYKALLKTEGVELEFTDDAIKRI 377 >gnl|CDD|144343 pfam00703, Glyco_hydro_2, domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities. Length = 108 Score = 25.1 bits (55), Expect = 6.4 Identities = 5/15 (33%), Positives = 11/15 (73%) Query: 24 DVINQIKIENPHLWT 38 I +++++NP LW+ Sbjct: 64 TTILELEVKNPKLWS 78 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.136 0.422 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,706,672 Number of extensions: 79898 Number of successful extensions: 171 Number of sequences better than 10.0: 1 Number of HSP's gapped: 165 Number of HSP's successfully gapped: 17 Length of query: 136 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 52 Effective length of database: 4,448,581 Effective search space: 231326212 Effective search space used: 231326212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 52 (24.0 bits)