RPSBLAST alignment of GI: peg_75 and MMDB domain: 3chh_A_

>3chh_A (A:) P-aminobenzoate N-oxygenase; DI-iron oxygenase, oxidoreductase; 2.00A {Streptomyces thioluteus} PDB: 3chi_A 3cht_A* 3chu_A 2jcd_ALength = 336
 Score = 69.1 bits (168), Expect = 2e-13
 Identities = 10/122 (8%), Positives = 32/122 (26%), Gaps = 11/122 (9%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
               +      +RDE+ H +  ++V+ ++         +   +     L      +++  
Sbjct: 213 QPMHSLITTLHLRDETAHGSIVVEVVRELYARMNEQQRRALVRCLPIALEAFAEQDLSAL 272

Query: 61  HETMPKGFVGLNAPSC-EQYMQFIANRRCHQIGLEPLFKYTENPFPWMSEVIDLKKEKNF 119
              +     G+         ++  A                      + + + L    +F
Sbjct: 273 LLELNA--AGIRGAEEIVGDLRSTAGGTRLVRDFSG-------ARKMVEQ-LGLDDAVDF 322

Query: 120 FE 121
             
Sbjct: 323 DF 324