RPSBLAST alignment of GI: peg_75 and protein with PDBid: 3dhz

>3dhz_A Ribonucleotide reductase subunit R2F; metal free, hydrogen bond, metal binding protein; 1.63A {Corynebacterium ammoniagenes} SCOP: a.25.1.2 PDB: 1kgo_A 1kgp_A 1oqu_A 1kgn_A 1uzr_A* Length = 329
 Score =  123 bits (310), Expect = 1e-29
 Identities = 25/134 (18%), Positives = 57/134 (42%), Gaps = 6/134 (4%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           +   A+  + I+RDES+H  +      Q   +      +E++  +  ++++    EI Y 
Sbjct: 188 LTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYT 247

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLF---KYTENPFPWMSEVIDLKKEK 117
            +      +G      ++++++ AN+  + +G E LF   +   +P    S   +  +  
Sbjct: 248 EDIYDD--LGWTE-DVKRFLRYNANKALNNLGYEGLFPTDETKVSPAILSSLSPNADENH 304

Query: 118 NFFETRVTEYQQGA 131
           +FF    + Y  G 
Sbjct: 305 DFFSGSGSSYVIGK 318