RPSBLAST alignment of GI: peg_75 and SCOP domain: d3dhza1

Alignment
>d3dhza1 a.25.1.2 (A:14-297) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 284
 Score = 69.8 bits (170), Expect = 8e-14
 Identities = 21/107 (19%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 1   MVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHEATLLEIAYA 60
           +   A+  + I+RDES+H  +      Q   +      +E++  +  ++++    EI Y 
Sbjct: 175 LTNTADIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYT 234

Query: 61  HETMPKGFVGLNAPSCEQYMQFIANRRCHQIGLEPLFKYTENPF-PW 106
            +      +G      ++++++ AN+  + +G E LF   E    P 
Sbjct: 235 EDIYDD--LGWTE-DVKRFLRYNANKALNNLGYEGLFPTDETKVSPA 278

SCOP domain information

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ribonucleotide reductase-like
domain: Ribonucleotide reductase R2
species: Corynebacterium ammoniagenes [TaxId: 1697]